BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20275 (778 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022179-1|AAY51573.1| 360|Drosophila melanogaster IP01239p pro... 33 0.44 AE013599-2438|AAF57887.1| 338|Drosophila melanogaster CG17287-P... 33 0.44 AE014298-773|AAF46060.1| 444|Drosophila melanogaster CG15779-PA... 29 7.1 AB162600-1|BAD42818.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162599-1|BAD42817.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162598-1|BAD42816.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162597-1|BAD42815.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162596-1|BAD42814.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162595-1|BAD42813.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162594-1|BAD42812.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162593-1|BAD42811.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162592-1|BAD42810.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162591-1|BAD42809.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162590-1|BAD42808.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162589-1|BAD42807.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162588-1|BAD42806.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162587-1|BAD42805.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162586-1|BAD42804.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162585-1|BAD42803.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162584-1|BAD42802.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162583-1|BAD42801.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162582-1|BAD42800.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162581-1|BAD42799.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162580-1|BAD42798.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162579-1|BAD42797.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162578-1|BAD42796.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162577-1|BAD42795.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162576-1|BAD42794.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162575-1|BAD42793.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162574-1|BAD42792.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162573-1|BAD42791.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162572-1|BAD42790.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162571-1|BAD42789.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162570-1|BAD42788.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162569-1|BAD42787.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162568-1|BAD42786.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162567-1|BAD42785.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162566-1|BAD42784.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162565-1|BAD42783.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162564-1|BAD42782.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162563-1|BAD42781.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162562-1|BAD42780.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162561-1|BAD42779.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162560-1|BAD42778.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162559-1|BAD42777.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162558-1|BAD42776.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162557-1|BAD42775.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162556-1|BAD42774.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162555-1|BAD42773.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162554-1|BAD42772.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162553-1|BAD42771.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162552-1|BAD42770.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162551-1|BAD42769.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162550-1|BAD42768.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162549-1|BAD42767.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162548-1|BAD42766.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162547-1|BAD42765.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162546-1|BAD42764.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162545-1|BAD42763.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162544-1|BAD42762.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162543-1|BAD42761.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162542-1|BAD42760.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162541-1|BAD42759.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162540-1|BAD42758.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162539-1|BAD42757.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162538-1|BAD42756.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162537-1|BAD42755.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162536-1|BAD42754.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162535-1|BAD42753.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162534-1|BAD42752.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162533-1|BAD42751.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162532-1|BAD42750.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162531-1|BAD42749.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162530-1|BAD42748.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162529-1|BAD42747.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162528-1|BAD42746.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162527-1|BAD42745.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162526-1|BAD42744.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162525-1|BAD42743.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162524-1|BAD42742.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162523-1|BAD42741.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162522-1|BAD42740.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162521-1|BAD42739.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162520-1|BAD42738.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162519-1|BAD42737.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162518-1|BAD42736.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162517-1|BAD42735.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162516-1|BAD42734.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162515-1|BAD42733.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162514-1|BAD42732.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162513-1|BAD42731.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162512-1|BAD42730.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162511-1|BAD42729.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162510-1|BAD42728.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162509-1|BAD42727.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162508-1|BAD42726.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162507-1|BAD42725.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162506-1|BAD42724.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162505-1|BAD42723.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162504-1|BAD42722.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162503-1|BAD42721.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162502-1|BAD42720.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162501-1|BAD42719.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162500-1|BAD42718.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162499-1|BAD42717.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162498-1|BAD42716.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162497-1|BAD42715.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162496-1|BAD42714.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162495-1|BAD42713.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162494-1|BAD42712.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162493-1|BAD42711.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162492-1|BAD42710.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162491-1|BAD42709.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162490-1|BAD42708.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162489-1|BAD42707.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162488-1|BAD42706.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162487-1|BAD42705.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162486-1|BAD42704.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162485-1|BAD42703.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162484-1|BAD42702.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162483-1|BAD42701.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162482-1|BAD42700.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162481-1|BAD42699.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162480-1|BAD42698.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162479-1|BAD42697.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162478-1|BAD42696.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162477-1|BAD42695.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162476-1|BAD42694.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162475-1|BAD42693.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162474-1|BAD42692.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162473-1|BAD42691.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162472-1|BAD42690.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162471-1|BAD42689.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162470-1|BAD42688.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162469-1|BAD42687.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162468-1|BAD42686.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162467-1|BAD42685.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162466-1|BAD42684.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162465-1|BAD42683.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162464-1|BAD42682.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162463-1|BAD42681.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162462-1|BAD42680.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162461-1|BAD42679.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162460-1|BAD42678.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162459-1|BAD42677.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162458-1|BAD42676.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162457-1|BAD42675.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162456-1|BAD42674.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162455-1|BAD42673.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162454-1|BAD42672.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162453-1|BAD42671.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162452-1|BAD42670.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162451-1|BAD42669.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162450-1|BAD42668.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB162449-1|BAD42667.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066643-1|BAB68267.1| 333|Drosophila melanogaster gustatory re... 29 7.1 AB066642-1|BAB68266.1| 333|Drosophila melanogaster gustatory re... 29 7.1 AB066641-1|BAB68265.1| 333|Drosophila melanogaster gustatory re... 29 7.1 AB066624-1|BAB68248.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066623-1|BAB68247.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066622-1|BAB68246.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066621-1|BAB68245.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066620-1|BAB68244.1| 444|Drosophila melanogaster gustatory re... 29 7.1 AB066619-1|BAB68243.1| 444|Drosophila melanogaster gustatory re... 29 7.1 >BT022179-1|AAY51573.1| 360|Drosophila melanogaster IP01239p protein. Length = 360 Score = 33.1 bits (72), Expect = 0.44 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 615 CFWIPNFYSLYHFKDFFINFFYVLIISFNVIYTFILCVLTIYLKCIF 755 C WI N ++FK F + FY + F Y F + V +YL C F Sbjct: 177 CPWIVNCVHFHNFKYFILFLFYAEVYCF---YLFCVMVYDLYLICGF 220 >AE013599-2438|AAF57887.1| 338|Drosophila melanogaster CG17287-PA protein. Length = 338 Score = 33.1 bits (72), Expect = 0.44 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 Query: 615 CFWIPNFYSLYHFKDFFINFFYVLIISFNVIYTFILCVLTIYLKCIF 755 C WI N ++FK F + FY + F Y F + V +YL C F Sbjct: 155 CPWIVNCVHFHNFKYFILFLFYAEVYCF---YLFCVMVYDLYLICGF 198 >AE014298-773|AAF46060.1| 444|Drosophila melanogaster CG15779-PA protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162600-1|BAD42818.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162599-1|BAD42817.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162598-1|BAD42816.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162597-1|BAD42815.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162596-1|BAD42814.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162595-1|BAD42813.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162594-1|BAD42812.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162593-1|BAD42811.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162592-1|BAD42810.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162591-1|BAD42809.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162590-1|BAD42808.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162589-1|BAD42807.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162588-1|BAD42806.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162587-1|BAD42805.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162586-1|BAD42804.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162585-1|BAD42803.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162584-1|BAD42802.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162583-1|BAD42801.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162582-1|BAD42800.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162581-1|BAD42799.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162580-1|BAD42798.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162579-1|BAD42797.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162578-1|BAD42796.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162577-1|BAD42795.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162576-1|BAD42794.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162575-1|BAD42793.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162574-1|BAD42792.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162573-1|BAD42791.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162572-1|BAD42790.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162571-1|BAD42789.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162570-1|BAD42788.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162569-1|BAD42787.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162568-1|BAD42786.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162567-1|BAD42785.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162566-1|BAD42784.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162565-1|BAD42783.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162564-1|BAD42782.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162563-1|BAD42781.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162562-1|BAD42780.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162561-1|BAD42779.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162560-1|BAD42778.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162559-1|BAD42777.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162558-1|BAD42776.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162557-1|BAD42775.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162556-1|BAD42774.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162555-1|BAD42773.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162554-1|BAD42772.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162553-1|BAD42771.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162552-1|BAD42770.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162551-1|BAD42769.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162550-1|BAD42768.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162549-1|BAD42767.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162548-1|BAD42766.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162547-1|BAD42765.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162546-1|BAD42764.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162545-1|BAD42763.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162544-1|BAD42762.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162543-1|BAD42761.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162542-1|BAD42760.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162541-1|BAD42759.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162540-1|BAD42758.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162539-1|BAD42757.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162538-1|BAD42756.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162537-1|BAD42755.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162536-1|BAD42754.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162535-1|BAD42753.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162534-1|BAD42752.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162533-1|BAD42751.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162532-1|BAD42750.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162531-1|BAD42749.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162530-1|BAD42748.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162529-1|BAD42747.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162528-1|BAD42746.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162527-1|BAD42745.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162526-1|BAD42744.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162525-1|BAD42743.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162524-1|BAD42742.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162523-1|BAD42741.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162522-1|BAD42740.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162521-1|BAD42739.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162520-1|BAD42738.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162519-1|BAD42737.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162518-1|BAD42736.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162517-1|BAD42735.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162516-1|BAD42734.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162515-1|BAD42733.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162514-1|BAD42732.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162513-1|BAD42731.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162512-1|BAD42730.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162511-1|BAD42729.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162510-1|BAD42728.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162509-1|BAD42727.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162508-1|BAD42726.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162507-1|BAD42725.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162506-1|BAD42724.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162505-1|BAD42723.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162504-1|BAD42722.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162503-1|BAD42721.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162502-1|BAD42720.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162501-1|BAD42719.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162500-1|BAD42718.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162499-1|BAD42717.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162498-1|BAD42716.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162497-1|BAD42715.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162496-1|BAD42714.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162495-1|BAD42713.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162494-1|BAD42712.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162493-1|BAD42711.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162492-1|BAD42710.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162491-1|BAD42709.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162490-1|BAD42708.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162489-1|BAD42707.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162488-1|BAD42706.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162487-1|BAD42705.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162486-1|BAD42704.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162485-1|BAD42703.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162484-1|BAD42702.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162483-1|BAD42701.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162482-1|BAD42700.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162481-1|BAD42699.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162480-1|BAD42698.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162479-1|BAD42697.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162478-1|BAD42696.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162477-1|BAD42695.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162476-1|BAD42694.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162475-1|BAD42693.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162474-1|BAD42692.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162473-1|BAD42691.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162472-1|BAD42690.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162471-1|BAD42689.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162470-1|BAD42688.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162469-1|BAD42687.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162468-1|BAD42686.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162467-1|BAD42685.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162466-1|BAD42684.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162465-1|BAD42683.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162464-1|BAD42682.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162463-1|BAD42681.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162462-1|BAD42680.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162461-1|BAD42679.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162460-1|BAD42678.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162459-1|BAD42677.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162458-1|BAD42676.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162457-1|BAD42675.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162456-1|BAD42674.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162455-1|BAD42673.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162454-1|BAD42672.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162453-1|BAD42671.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162452-1|BAD42670.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162451-1|BAD42669.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162450-1|BAD42668.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB162449-1|BAD42667.1| 444|Drosophila melanogaster gustatory receptor for trehalose protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066643-1|BAB68267.1| 333|Drosophila melanogaster gustatory receptor GR5a protein. Length = 333 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 22 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 49 >AB066642-1|BAB68266.1| 333|Drosophila melanogaster gustatory receptor GR5a protein. Length = 333 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 22 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 49 >AB066641-1|BAB68265.1| 333|Drosophila melanogaster gustatory receptor GR5a protein. Length = 333 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 22 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 49 >AB066624-1|BAB68248.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066623-1|BAB68247.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066622-1|BAB68246.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066621-1|BAB68245.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066620-1|BAB68244.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 >AB066619-1|BAB68243.1| 444|Drosophila melanogaster gustatory receptor GR5a protein. Length = 444 Score = 29.1 bits (62), Expect = 7.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 457 FNKPTWRFYFISL*TCQTCLFVCNCVRR 540 FN+ +WRF++ SL C T + + +RR Sbjct: 85 FNRRSWRFWYSSLYLCSTSVDLAFSIRR 112 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,511,274 Number of Sequences: 53049 Number of extensions: 545833 Number of successful extensions: 1077 Number of sequences better than 10.0: 164 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1075 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -