BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20273 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) 32 0.55 SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) 28 9.0 >SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) Length = 282 Score = 31.9 bits (69), Expect = 0.55 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +3 Query: 102 EFFYGVTLSSSHQSETWDPEAKAEYPR----SNKLVIRQALLGPDA 227 E F+G LS S + TW+PE E +KLV+ QA LG A Sbjct: 7 EDFWGCVLSKSEDTVTWNPEFDGEDTLLGQIEHKLVLSQACLGSKA 52 >SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 29.5 bits (63), Expect = 2.9 Identities = 24/83 (28%), Positives = 40/83 (48%) Frame = +2 Query: 125 FIITSVRDMGSRGKSRIPTQQQARHSSSIVRSRCQTR*IKCDTVEAMSLQEAVKLPVAVL 304 F+ T R + R KS +P + HS S+ RSR TR ++ T++ +L + +L Sbjct: 362 FLFTMER-LNDRRKS-VPVRMDKHHSLSVRRSRYITRSMEPITIQPSNLLTSFRLGTEPP 419 Query: 305 KVGESRHVRLDIEFPDAPVTFTL 373 V ES+ + ++ D TL Sbjct: 420 PVPESKTLAKLLDASDIGKLHTL 442 >SB_34957| Best HMM Match : PARP (HMM E-Value=4.4e-12) Length = 1392 Score = 27.9 bits (59), Expect = 9.0 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +1 Query: 106 FSMVSPFHHHISQRHGIQRQKQNTHAATSSSFVK 207 FS+ P I+ RHG+ RQK HA+ SF K Sbjct: 338 FSLHRPVED-INYRHGLGRQKLLFHASRGKSFYK 370 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,449,539 Number of Sequences: 59808 Number of extensions: 394236 Number of successful extensions: 958 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 957 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -