BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20272 (786 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IM44 Cluster: Putative uncharacterized protein; n=2; ... 36 1.5 UniRef50_Q54EE0 Cluster: Putative uncharacterized protein; n=4; ... 34 3.5 >UniRef50_Q8IM44 Cluster: Putative uncharacterized protein; n=2; Plasmodium|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 686 Score = 35.5 bits (78), Expect = 1.5 Identities = 30/98 (30%), Positives = 46/98 (46%) Frame = -1 Query: 645 NFFYIYKLVANDVDIIITYVL*QQDAKVLFDYVFNKLRLHFYVNLC*IKYT*KMFNNFIV 466 N YIYK+V + D + Y+ Q + F+Y K + Y++L K K N +I Sbjct: 582 NIDYIYKIVKEEYDKVEAYLKRDQFDEEDFEY---KHLVPIYLDL---KKELKKVNEYIK 635 Query: 465 YSHTNL*RYINVLLNLPNTSVNQTATSHSNNNEKVFFL 352 + + NL ++N + N S N T N EK+F L Sbjct: 636 F-YGNLISFVNFIQKYANPSTNIVKT-EENGEEKIFDL 671 >UniRef50_Q54EE0 Cluster: Putative uncharacterized protein; n=4; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 558 Score = 34.3 bits (75), Expect = 3.5 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Frame = -1 Query: 555 DYVF-NKLRLHFYVNLC*IKYT*KMFNNFI--VYSHTNL*RYINVLLNLPNTSVNQTATS 385 DY F N++ +F+VN KY+ K+FN+FI VY + + + N S+N + Sbjct: 50 DYKFKNEIINYFFVNWNWFKYSQKLFNHFIPHVYLDNDREYDDDFFRSYYNNSINNNNNN 109 Query: 384 HSNNN 370 ++NNN Sbjct: 110 NNNNN 114 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,006,447 Number of Sequences: 1657284 Number of extensions: 13950025 Number of successful extensions: 28910 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28855 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66673674990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -