BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20272 (786 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0266 - 16582912-16584918,16585041-16585229 28 9.7 09_02_0607 - 11183382-11183387,11183481-11183637,11184220-111842... 28 9.7 >12_02_0266 - 16582912-16584918,16585041-16585229 Length = 731 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -2 Query: 743 MKLIFTFTREPLVLCSRRLEDIILF 669 MK++ REP ++C+ R E +++F Sbjct: 1 MKMLNLHNREPFLICNGRYESVLIF 25 >09_02_0607 - 11183382-11183387,11183481-11183637,11184220-11184284, 11184397-11184469,11184759-11184905,11185515-11185562, 11185637-11185716,11186112-11186439,11186525-11186576, 11187397-11187523,11187613-11187990 Length = 486 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +3 Query: 603 YQRHWLLVCKCKRNCRARCERPKEDNIFQPSTAKYQRFPCESKDQLHS 746 +Q+H+L+ + +R R C R ++D I + Q+F + K + HS Sbjct: 406 HQKHYLVTPEIRRELRMSCNRGEKDTIMRNG----QQFAVDLKIRSHS 449 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,880,344 Number of Sequences: 37544 Number of extensions: 334718 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -