BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20272 (786 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9417| Best HMM Match : FragX_IP (HMM E-Value=0) 30 2.4 SB_40038| Best HMM Match : zf-ZPR1 (HMM E-Value=6.2e-23) 28 9.9 >SB_9417| Best HMM Match : FragX_IP (HMM E-Value=0) Length = 875 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 Query: 249 PRINKLNGGLHFRATQNSDFFQEIAILNY 335 P INKL G +HF T + F QE+ L++ Sbjct: 71 PEINKLKGFMHFAMTVVTRFCQEVKTLSH 99 >SB_40038| Best HMM Match : zf-ZPR1 (HMM E-Value=6.2e-23) Length = 406 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 658 ASAQKRIISSSLLLQSTNGSRVKVKISFIPGLLWLPHD 771 AS + +I+ SLL Q+ GS + K+ +P PH+ Sbjct: 181 ASLKIKILQDSLLKQTKKGSNIPNKLQLLPSPYRDPHE 218 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,727,206 Number of Sequences: 59808 Number of extensions: 423412 Number of successful extensions: 624 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 624 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -