BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20271 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.33 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 1.0 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 23 3.1 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 21 7.2 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 21 7.2 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 25.8 bits (54), Expect = 0.33 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -3 Query: 418 YALYFFLCMQIFFLQVSLFILNVLFLYF*EL*HSLEFLVLCV*IFRFEFI 269 YA LC+ F+ +F +++LFL F +LC+ F FI Sbjct: 105 YAFIILLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFI 154 Score = 25.4 bits (53), Expect = 0.44 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 412 LYFFLCMQIFFLQVSLFILNVLFL 341 L+F LC+ F+ +F +++LFL Sbjct: 140 LFFLLCIYYFYCAFIIFTVHLLFL 163 Score = 25.0 bits (52), Expect = 0.58 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = -3 Query: 421 LYALYFFLCMQIFFLQVSLFILNVLFLYF*EL*HSLEFLVLCV*IF 284 L +Y+F C I F LF+L + + + ++ L C IF Sbjct: 143 LLCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFCCAFIF 188 Score = 21.8 bits (44), Expect = 5.4 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 493 SGAANYACILINCLKKLSNDKRNRLYALYFFLCMQIFFLQVSLFIL 356 SGA+ IL + + K N +R +Y+F C+ I F LF+L Sbjct: 34 SGASLQVGILDSLVFKCYNLRR-----IYYFYCVSITFNVHLLFLL 74 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 475 HSWQHHWLKLLFRILSTIDRELLKPSASVAL 567 H W H W+ LL L I +++ VAL Sbjct: 542 HVWIHPWIPLLDTRLQAIIYPIIQEKLGVAL 572 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 415 HTVCSSCHWTVS*GS*SKYRHSWQH 489 HT CS C T GS RH H Sbjct: 72 HTECSKCSETQKNGSKKIMRHLIDH 96 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 204 NNSNLFHCFYS*ENS 160 +N N FH FYS E+S Sbjct: 475 DNYNSFHQFYSSESS 489 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 204 NNSNLFHCFYS*ENS 160 +N N FH FYS E+S Sbjct: 423 DNYNSFHQFYSSESS 437 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,840 Number of Sequences: 336 Number of extensions: 3276 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -