BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20268 (518 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 25 0.53 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 24 0.70 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 21 6.5 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 21 6.5 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 21 6.5 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 8.7 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 21 8.7 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 21 8.7 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 24.6 bits (51), Expect = 0.53 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 327 QRRCRSGESPPEPLGR 374 Q +C +GE+P +P+GR Sbjct: 48 QLKCATGEAPCDPVGR 63 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 24.2 bits (50), Expect = 0.70 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 284 WLESNFSIPSIKTSGSSQWRRLQQTEAQSFHW 189 WL+SN S+ + + S Q T+ SF++ Sbjct: 13 WLKSNSSLAGFEVNSSEQLTTPTPTDINSFYF 44 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 239 SSQWRRLQQTEAQSFHWCRRHGDS 168 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 239 SSQWRRLQQTEAQSFHWCRRHGDS 168 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.0 bits (42), Expect = 6.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -1 Query: 239 SSQWRRLQQTEAQSFHWCRRHGDS 168 S++ + + A + W + HGDS Sbjct: 155 SAEENSVSEPPANFYPWMKAHGDS 178 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 327 QRRCRSGESPPEPLGRS 377 ++R + G PPEP+ S Sbjct: 309 KKRMKEGLIPPEPISAS 325 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 327 QRRCRSGESPPEPLGRS 377 ++R + G PPEP+ S Sbjct: 98 KKRMKEGLIPPEPISAS 114 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 327 QRRCRSGESPPEPLGRS 377 ++R + G PPEP+ S Sbjct: 98 KKRMKEGLIPPEPISAS 114 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,362 Number of Sequences: 336 Number of extensions: 2153 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12468463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -