BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20265 (764 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT022179-1|AAY51573.1| 360|Drosophila melanogaster IP01239p pro... 36 0.080 AE013599-2438|AAF57887.1| 338|Drosophila melanogaster CG17287-P... 36 0.080 >BT022179-1|AAY51573.1| 360|Drosophila melanogaster IP01239p protein. Length = 360 Score = 35.5 bits (78), Expect = 0.080 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 614 CFWIPNFYSLHHFKDFFINFFYVLIISFNVIYTFILCVLTIYLKCIF 754 C WI N H+FK F + FY + F Y F + V +YL C F Sbjct: 177 CPWIVNCVHFHNFKYFILFLFYAEVYCF---YLFCVMVYDLYLICGF 220 >AE013599-2438|AAF57887.1| 338|Drosophila melanogaster CG17287-PA protein. Length = 338 Score = 35.5 bits (78), Expect = 0.080 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 614 CFWIPNFYSLHHFKDFFINFFYVLIISFNVIYTFILCVLTIYLKCIF 754 C WI N H+FK F + FY + F Y F + V +YL C F Sbjct: 155 CPWIVNCVHFHNFKYFILFLFYAEVYCF---YLFCVMVYDLYLICGF 198 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,558,344 Number of Sequences: 53049 Number of extensions: 552007 Number of successful extensions: 1050 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3520086471 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -