BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20264 (657 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 2.8 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 3.7 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 24.6 bits (51), Expect = 2.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNR 418 RT LNRS A+ A ++Q H R + ++ Sbjct: 600 RTLNLLNRSTDHALLAQKRQEHQRLVRECDK 630 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.2 bits (50), Expect = 3.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 307 WWVTVYFNV*SCIGVIGELAALAARLFGVSRCQYLFELGFSVAFSL 170 WW + FN S GV G A AAR ++ FS+ +S+ Sbjct: 245 WWGWLAFNSGSTYGVSGAKWAYAARAAVMTMMGSFGGGSFSIIYSM 290 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 715,391 Number of Sequences: 2352 Number of extensions: 14531 Number of successful extensions: 250 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -