BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20264 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 30 0.017 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 30 0.017 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 30 0.017 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 30 0.017 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 30 0.017 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 30 0.017 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 30 0.017 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 30 0.017 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 30 0.017 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 30 0.017 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 30 0.017 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 30 0.017 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 30 0.017 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 30 0.017 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 30 0.022 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 30 0.022 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 29 0.039 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 29 0.052 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 29 0.052 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 28 0.068 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 28 0.068 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 28 0.068 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 28 0.068 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 27 0.16 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 27 0.16 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 27 0.16 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 27 0.16 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 27 0.16 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 27 0.16 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 27 0.16 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 27 0.16 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 27 0.16 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 27 0.16 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 27 0.21 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 27 0.21 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 27 0.21 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 27 0.21 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 26 0.28 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 26 0.28 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 25 0.48 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 25 0.48 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 25 0.48 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 25 0.48 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 25 0.48 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 25 0.48 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 25 0.64 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 25 0.84 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 25 0.84 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 25 0.84 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 25 0.84 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 25 0.84 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 25 0.84 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 25 0.84 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 25 0.84 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 25 0.84 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 25 0.84 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 24 1.5 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 24 1.5 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 24 1.5 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 1.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 24 1.5 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 1.5 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.5 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 24 1.5 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 24 1.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 1.9 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 1.9 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 1.9 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 1.9 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 1.9 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 1.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 23 1.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 23 1.9 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 23 1.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.6 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 23 3.4 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 3.4 AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 23 3.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.9 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 5.9 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 5.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.9 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 7.8 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSR 263 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 260 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 299 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERRCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS N NY Y +N Sbjct: 279 RKYRETSKGRSRDRTERERSKETKIISSNNYNYKN-YNNN 317 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS N NY Y +N Sbjct: 290 RKYRETSKGRSRDRTERERSKETKIISSNNYNYKN-YNNN 328 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSR 274 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 274 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S+K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSHKRYSR 274 Score = 28.7 bits (61), Expect = 0.052 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEKPS 197 R+S S R + + E +Y++ +T + DR+E+ K S Sbjct: 271 RYSRSREREQKSYKNEREYRKYRETSKERFRDRRERERSKES 312 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRKRYSR 274 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS++ NY+ Y +N Sbjct: 290 RKYRETSKERSRDRTERERSKERKIISSLSNNYN--YNNN 327 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKLLEERTSRKRYSR 263 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 229 FQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRKRYSR 279 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 30.3 bits (65), Expect = 0.017 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYREKDRRYEKLHNEKEKLLEERTSRKRYSR 274 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 271 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSK 310 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 29.9 bits (64), Expect = 0.022 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 29.9 bits (64), Expect = 0.022 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRQYEKLHNEKEKFLEERTSRKRYSR 274 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 29.1 bits (62), Expect = 0.039 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 290 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 330 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 28.7 bits (61), Expect = 0.052 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++SR + D R + R KLH+ KEK E+ +S + + R Sbjct: 224 FQHTSSRYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSRERYSR 274 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y ++ +S E+ P+ ISS++ NY Sbjct: 290 RKYGETSKERSRDRTERERSKEPKIISSLSNNY 322 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 28.7 bits (61), Expect = 0.052 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNK 206 F H++SR + D R + R KLH+ KEK E+ +S K Sbjct: 224 FQHTSSRYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRK 270 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 28.3 bits (60), Expect = 0.068 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEKPSSNKYWHRLTPN 230 R+S S R + + E +Y++ +T + DRKE+ EK +K L+ N Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRKER--EKSKEHKIISSLSNN 88 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS++ NY+ Y +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNN 94 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 28.3 bits (60), Expect = 0.068 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEKPSSNKYWHRLTPN 230 R+S S R + + E +Y++ +T + DRKE+ EK +K L+ N Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRKER--EKSKEHKIISSLSNN 88 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS++ NY+ Y +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNN 94 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 28.3 bits (60), Expect = 0.068 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEKPSSNKYWHRLTPN 230 R+S S R + + E +Y++ +T + DRKE+ EK +K L+ N Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRKER--EKSKEHKIISSLSNN 88 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYSTMYKSN 445 R Y+ ++ +S E+ + ISS++ NY+ Y +N Sbjct: 57 RKYRETSKERSRDRKEREKSKEHKIISSLSNNYN--YNNN 94 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 28.3 bits (60), Expect = 0.068 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSHYSRERSCSRDRNREYKEKDRRYEKLHNEKEKLLEERTSRKRYSR 274 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 271 RYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSK 310 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ ++ +S E+ P+ ISS++ NY Sbjct: 290 RKYRETSKERSRDRKERERSKEPKIISSLSNNY 322 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSK 77 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSK 77 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSK 77 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 38 RYSRSREREKKSYKNENSYRKYRETSKERSRDRKERERSK 77 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 27.1 bits (57), Expect = 0.16 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DRKE+ K Sbjct: 38 RYSRSREREQKSYKNENSYRKYRETSKERSRDRKERERSK 77 Score = 24.2 bits (50), Expect = 1.1 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ ++ +S E+ P+ ISS++ NY Sbjct: 57 RKYRETSKERSRDRKERERSKEPKIISSLSNNY 89 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 290 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 330 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 290 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 330 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 290 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 330 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 224 FQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 274 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 290 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 330 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 75 FSHSTSRLNPNSETEEDYKRSVQTLPR---KLHDRKEKATEKPSSNKYWHR 218 F H++S + D R + R KLH+ KEK E+ +S K + R Sbjct: 213 FQHTSSHYSRERSCSRDRNREYRKKDRRYEKLHNEKEKLLEERTSCKRYSR 263 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 279 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 319 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.6 bits (56), Expect = 0.21 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DRKE+ K Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRKERERSK 77 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ +R +S E+ P+ ISS++ NY Sbjct: 57 REYRETSRERSRDRKERERSKEPKIISSLSNNY 89 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.6 bits (56), Expect = 0.21 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DRKE+ K Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRKERERSK 77 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ +R +S E+ P+ ISS++ NY Sbjct: 57 REYRETSRERSRDRKERERSKEPKIISSLSNNY 89 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.6 bits (56), Expect = 0.21 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DRKE+ K Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRKERERSK 77 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ +R +S E+ P+ ISS++ NY Sbjct: 57 REYRETSRERSRDRKERERSKEPKIISSLSNNY 89 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 26.6 bits (56), Expect = 0.21 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DRKE+ K Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRKERERSK 77 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ +R +S E+ P+ ISS++ NY Sbjct: 57 REYRETSRERSRDRKERERSKEPKIISSLSNNY 89 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y++ +T + DR+E+ K Sbjct: 38 RYSRSREREQNSYKNEREYRKYRETSKERSRDRRERERSK 77 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRRERERSKEPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y+ ++ +S E+ P+ ISS++ NY+ + Y +N Sbjct: 57 RKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 25.0 bits (52), Expect = 0.64 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E Y++ +T + DR+E+ + Sbjct: 271 RYSRSREREQKSYKNENSYRKYRETSKERSRDRRERGRSR 310 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS 427 R Y+ ++ +S E+ P+ ISS++ NY+ Sbjct: 57 RKYRETSKERSRDRTERERSREPKIISSLSNNYN 90 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 38 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 77 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+E+ + Sbjct: 287 RYSRSREREQKSYKNEREYREYRETSRERSRDRRERGRSR 326 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ ++ +S E P+ ISS++ NY Sbjct: 57 RKYRETSKERSQDRTERETSKEPKIISSLSNNY 89 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 R Y+ ++ +S E P+ ISS++ NY Sbjct: 57 RKYRETSKERSQDRTERETSKEPKIISSLSNNY 89 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSRKRYSR 41 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -2 Query: 323 PA*QVLVGNR--LF*RLKLHWRYWR 255 PA + G+ +F KL+WRYW+ Sbjct: 551 PASMTIPGSNSAVFTNYKLYWRYWQ 575 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 579 EPGMEKLYPILMDIRMAIASLL 644 +P ++K YP++MD ++ I +L Sbjct: 34 KPLLKKEYPLVMDTKLKIIEIL 55 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 57 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 97 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSCKRYSR 41 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 57 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 97 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSCKRYSR 41 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 57 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 97 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSCKRYSR 41 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 1.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 326 RTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYS-TMYKSN 445 R Y ++ +S E+ P+ ISS++ NY+ Y +N Sbjct: 57 RKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNN 97 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKLLEERTSCKRYSR 41 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 156 KLHDRKEKATEKPSSNKYWHR 218 KLH+ KEK E+ +S K + R Sbjct: 21 KLHNEKEKFLEERTSRKRYSR 41 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 579 EPGMEKLYPILMDIRMAIASLL 644 +P ++K YP++MD ++ I +L Sbjct: 2 KPLLKKEYPLVMDTKLKIIEIL 23 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 477 AIEEPRNRVYKNRSQRDSLMLFP 545 A+EE R R Y R +RD ++ P Sbjct: 416 AVEEERQREYGIRVERDPILTPP 438 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -3 Query: 307 WWVTVYFNV*SCIGVIGELAALAAR 233 WW + FN S GV G+ AAR Sbjct: 232 WWGWLAFNSGSTYGVSGQRWQYAAR 256 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -3 Query: 250 AALAARLFGVSRCQYLFELGFSVAFSL 170 A LAAR S C Y+ S AFS+ Sbjct: 329 AVLAAREITSSSCSYMAHEKLSYAFSV 355 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 493 LGSSIALVFHQVCLGGIRLVHCRIVS 416 LGS I ++ C G IR HC ++ Sbjct: 58 LGSIIFVISFFGCCGAIRESHCMTIT 83 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 138 VQTLPRKLHDRKEKATEKPSSNKYWH 215 VQ +P K+ D+ +K +WH Sbjct: 19 VQAVPNKVADKTYVTRQKNIYELFWH 44 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +3 Query: 156 KLHDRKEK-ATEKPSSNKY 209 KLH+ KEK E+ S N+Y Sbjct: 21 KLHNEKEKLLEERTSRNRY 39 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 332 YKALNRSKSFAMGAPEQQTHPRYISSMNRNY 424 Y+ ++ +S E+ P+ ISS++ NY Sbjct: 59 YRETSKERSRDRTERERCKEPKIISSLSNNY 89 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +3 Query: 138 VQTLPRKLHDRKEKATEKPSSNKYWH 215 VQ +P K+ D+ +K +WH Sbjct: 19 VQAVPNKVADKTYVTRQKNIYELFWH 44 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/40 (22%), Positives = 19/40 (47%) Frame = +3 Query: 72 RFSHSTSRLNPNSETEEDYKRSVQTLPRKLHDRKEKATEK 191 R+S S R + + E +Y+ +T + DR+ + + Sbjct: 286 RYSRSREREQKSYKNEREYREYRETSRERSRDRRGRGRSR 325 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 7.8 Identities = 14/59 (23%), Positives = 28/59 (47%) Frame = +2 Query: 254 LSNNANATLDVKINGYPPGPAKPARTYKALNRSKSFAMGAPEQQTHPRYISSMNRNYST 430 +S + TL+ K N P+K ++T + ++ + P ++ +S +NR ST Sbjct: 343 VSYPSTETLNTKCNTLERTPSKCSQTSVHYSNGQTHSQLCPTPRSTHLKVSGINRVGST 401 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,544 Number of Sequences: 438 Number of extensions: 4331 Number of successful extensions: 181 Number of sequences better than 10.0: 110 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 181 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -