BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20258 (349 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.34 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 4.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 9.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 9.6 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 24.6 bits (51), Expect = 0.34 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -1 Query: 139 IHNVNTCDSFSYNTDLGQFRSNSTSNF 59 IHN N ++ +YN + + +N+ +N+ Sbjct: 323 IHNNNNYNNNNYNNNYNNYNNNNYNNY 349 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 4.2 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 237 LLLNTKKDQDEERDQKEI 290 L+ KKD+DEE +++ + Sbjct: 350 LIERPKKDEDEEEEEEVV 367 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 19.8 bits (39), Expect = 9.6 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -2 Query: 342 ILIIYSSFNGIDSRWEERFLSDLFPRLDLSSCLVRALRIARVFLALK 202 I+ + + G+ + + + LFP L+ L+R L + LK Sbjct: 218 IMCYFCIWKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLK 264 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 19.8 bits (39), Expect = 9.6 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -2 Query: 342 ILIIYSSFNGIDSRWEERFLSDLFPRLDLSSCLVRALRIARVFLALK 202 I+ + + G+ + + + LFP L+ L+R L + LK Sbjct: 271 IMCYFCIWKGVKWTGKVVYFTSLFPYALLTILLIRGLTLPGAMEGLK 317 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,648 Number of Sequences: 438 Number of extensions: 982 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7936320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -