BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20258 (349 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02610.1 68418.m00197 60S ribosomal protein L35 (RPL35D) ribo... 91 2e-19 At2g39390.1 68415.m04834 60S ribosomal protein L35 (RPL35B) 91 2e-19 At3g55170.2 68416.m06128 60S ribosomal protein L35 (RPL35C) vari... 91 2e-19 At3g55170.1 68416.m06127 60S ribosomal protein L35 (RPL35C) vari... 91 2e-19 At3g09500.1 68416.m01129 60S ribosomal protein L35 (RPL35A) simi... 91 2e-19 >At5g02610.1 68418.m00197 60S ribosomal protein L35 (RPL35D) ribosomal protein L35- cytosolic, Arabidopsis thaliana, PIR:T00549 Length = 123 Score = 91.1 bits (216), Expect = 2e-19 Identities = 46/67 (68%), Positives = 52/67 (77%) Frame = +2 Query: 50 RVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAM 229 RVAKVTGG +KLSKI+VVRK+IA+V V QK K LR YKNKK PLDLR KKTRA+ Sbjct: 32 RVAKVTGGAPNKLSKIKVVRKSIAQVLTVISQKQKSALREAYKNKKLLPLDLRPKKTRAI 91 Query: 230 RKALTKH 250 R+ LTKH Sbjct: 92 RRRLTKH 98 >At2g39390.1 68415.m04834 60S ribosomal protein L35 (RPL35B) Length = 123 Score = 91.1 bits (216), Expect = 2e-19 Identities = 46/67 (68%), Positives = 52/67 (77%) Frame = +2 Query: 50 RVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAM 229 RVAKVTGG +KLSKI+VVRK+IA+V V QK K LR YKNKK PLDLR KKTRA+ Sbjct: 32 RVAKVTGGAPNKLSKIKVVRKSIAQVLTVISQKQKSALREAYKNKKLLPLDLRPKKTRAI 91 Query: 230 RKALTKH 250 R+ LTKH Sbjct: 92 RRRLTKH 98 >At3g55170.2 68416.m06128 60S ribosomal protein L35 (RPL35C) various ribosomal L35 proteins Length = 123 Score = 90.6 bits (215), Expect = 2e-19 Identities = 46/67 (68%), Positives = 52/67 (77%) Frame = +2 Query: 50 RVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAM 229 RVAKVTGG +KLSKI+VVRK+IA+V V QK K LR YKNKK PLDLR KKTRA+ Sbjct: 32 RVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQKSALREAYKNKKLLPLDLRPKKTRAI 91 Query: 230 RKALTKH 250 R+ LTKH Sbjct: 92 RRRLTKH 98 >At3g55170.1 68416.m06127 60S ribosomal protein L35 (RPL35C) various ribosomal L35 proteins Length = 123 Score = 90.6 bits (215), Expect = 2e-19 Identities = 46/67 (68%), Positives = 52/67 (77%) Frame = +2 Query: 50 RVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAM 229 RVAKVTGG +KLSKI+VVRK+IA+V V QK K LR YKNKK PLDLR KKTRA+ Sbjct: 32 RVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQKSALREAYKNKKLLPLDLRPKKTRAI 91 Query: 230 RKALTKH 250 R+ LTKH Sbjct: 92 RRRLTKH 98 >At3g09500.1 68416.m01129 60S ribosomal protein L35 (RPL35A) similar to 60S ribosomal protein L35 GB:AAC27830 Length = 123 Score = 90.6 bits (215), Expect = 2e-19 Identities = 46/67 (68%), Positives = 52/67 (77%) Frame = +2 Query: 50 RVAKVTGGVASKLSKIRVVRKAIARVYIVYHQKMKVNLRNHYKNKKYKPLDLRAKKTRAM 229 RVAKVTGG +KLSKI+VVRK+IA+V V QK K LR YKNKK PLDLR KKTRA+ Sbjct: 32 RVAKVTGGAPNKLSKIKVVRKSIAQVLTVSSQKQKSALREAYKNKKLLPLDLRPKKTRAI 91 Query: 230 RKALTKH 250 R+ LTKH Sbjct: 92 RRRLTKH 98 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,494,128 Number of Sequences: 28952 Number of extensions: 83259 Number of successful extensions: 223 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 223 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -