BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20254 (711 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC129927-1|AAI29928.1| 1323|Homo sapiens PH domain and leucine r... 30 9.4 >BC129927-1|AAI29928.1| 1323|Homo sapiens PH domain and leucine rich repeat protein phosphatase-like protein. Length = 1323 Score = 29.9 bits (64), Expect = 9.4 Identities = 14/53 (26%), Positives = 27/53 (50%) Frame = +3 Query: 24 IYIPLLHTCINIWETLGRDKSKLVEELNDLRKRGMKVDSVPTLMEAVDTLDTM 182 +++ +LH N +T K +E+L +L G K+ ++PT + L T+ Sbjct: 644 LHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTL 696 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,966,225 Number of Sequences: 237096 Number of extensions: 1660956 Number of successful extensions: 6141 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6141 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8287202872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -