BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20254 (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41160.1 68418.m05003 purine permease-related similar to puri... 28 7.0 At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ... 27 9.3 At5g38700.1 68418.m04679 expressed protein 27 9.3 >At5g41160.1 68418.m05003 purine permease-related similar to purine permease [Arabidopsis thaliana] GI:7620007; contains Pfam profile PF03151: Domain of unknown function, DUF250 Length = 358 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -1 Query: 696 SVMLLYFHQNLLN**CQKITYFNSIYGIP*N*YRIVCL*FFTVFLIKIN 550 SV LLY + + C FN ++ N +I CL FF+V + I+ Sbjct: 119 SVGLLYLSASTYSILCASQLAFNGVFYYYINSQKITCLIFFSVLFLSIS 167 >At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong similarity to RNA helicase RH25 [Arabidopsis thaliana] GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH31 GI:3776030 Length = 522 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +3 Query: 54 NIWETLGRDKSKLVEELNDLRKRGMKVDSVPTLMEAV 164 N + +GRDK +LVE N+ R M +D+ P + + + Sbjct: 472 NSQKMIGRDKDRLVELANEF-SRSMGLDNPPAIPKLI 507 >At5g38700.1 68418.m04679 expressed protein Length = 161 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 279 WSLHFRTLNHNNNDDSFKYLSVY 211 +S H + LNH+N+ D+ +YL+ Y Sbjct: 24 FSKHLKALNHHNSVDNNRYLTRY 46 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,693,292 Number of Sequences: 28952 Number of extensions: 255946 Number of successful extensions: 581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -