BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.11 |nxt3||ubiquitin protease cofactor |Schizosaccharomyc... 31 0.13 SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit ... 26 4.9 >SPBP8B7.11 |nxt3||ubiquitin protease cofactor |Schizosaccharomyces pombe|chr 2|||Manual Length = 434 Score = 31.5 bits (68), Expect = 0.13 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +1 Query: 352 RE*SKNNHASPDATQTEKL*REK*KQTFASGADSDKHSQRSREEGH 489 RE + SPDA + EK ++ + + +G S +H ++EEGH Sbjct: 136 REDVEEEEESPDAVEKEK--KDVASEPYVNGVQSQEHLPSAKEEGH 179 >SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit Pmc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 879 Score = 26.2 bits (55), Expect = 4.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 624 CLHLRSVFFLFRRFKLGRQRCTGHLRGV 541 CL+ R + F+L R+ GHLRGV Sbjct: 270 CLYQRLNLLSQQTFQLSRESWLGHLRGV 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,736,903 Number of Sequences: 5004 Number of extensions: 47967 Number of successful extensions: 129 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -