BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 7.5 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 7.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 9.9 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -2 Query: 204 YSWTHWRRHCEPKLNHR--FGNI 142 Y ++HW RH P L +GNI Sbjct: 19 YIYSHWERHGLPHLKPEIPYGNI 41 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.4 bits (48), Expect = 7.5 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -2 Query: 204 YSWTHWRRHCEPKLNHR--FGNI 142 Y ++HW RH P L +GNI Sbjct: 19 YIYSHWERHGLPHLKPEIPYGNI 41 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.0 bits (47), Expect = 9.9 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 Query: 224 PSGLRPRGQRPPARNEAPVSLLEYRKIPSLKGKSLLKSNQTDAESDPK 367 P RP+ QR R A L+E +SLL QT +D + Sbjct: 478 PQQQRPQQQRSQQRKPAKPELIEVSPNEGQDWESLLLLVQTAVRTDER 525 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,539 Number of Sequences: 2352 Number of extensions: 12752 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -