BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF521189-1|AAM77664.1| 811|Homo sapiens endothelin-converting e... 37 0.066 BC045554-1|AAH45554.2| 498|Homo sapiens PDXDC1 protein protein. 31 4.3 >AF521189-1|AAM77664.1| 811|Homo sapiens endothelin-converting enzyme-2C protein. Length = 811 Score = 37.1 bits (82), Expect = 0.066 Identities = 20/48 (41%), Positives = 26/48 (54%) Frame = -2 Query: 681 SNGHECGSPRFAGWLWFLRCLHLRSVFFLFRRFKLGRQRCTGHLRGVR 538 S G G+PR +G W + C HLRS+ L R +G Q+ T L G R Sbjct: 55 SPGMTPGTPRSSGLFWRVTCPHLRSISGLCSRTMVGFQKGTRQLLGSR 102 >BC045554-1|AAH45554.2| 498|Homo sapiens PDXDC1 protein protein. Length = 498 Score = 31.1 bits (67), Expect = 4.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 9 VTPEGWEKCNTTIQYDVETKKLWTELQRPYGNQS 110 +T GW C TT +YD +L T L G Q+ Sbjct: 463 MTAAGWSHCGTTTRYDCVRSRLTTRLPGSTGEQA 496 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,426,415 Number of Sequences: 237096 Number of extensions: 2007521 Number of successful extensions: 6006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6006 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -