BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97017-6|AAB52362.1| 374|Caenorhabditis elegans Hypothetical pr... 29 2.6 AC024202-12|AAF36031.2| 143|Caenorhabditis elegans Hypothetical... 28 8.0 >U97017-6|AAB52362.1| 374|Caenorhabditis elegans Hypothetical protein F47B3.7 protein. Length = 374 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 210 SHYSWTHWRRHCEPKLNHRFGNISLTES 127 +HY WT+W H P +N G I+L E+ Sbjct: 228 THYQWTNWPDHGAPPIN--MGAINLIEA 253 >AC024202-12|AAF36031.2| 143|Caenorhabditis elegans Hypothetical protein Y71H2B.1 protein. Length = 143 Score = 27.9 bits (59), Expect = 8.0 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 597 EKRHSEDGDT*ETKASQQTVETHTHAHYSGKLG 695 EKRH ED D K ++ + A Y GK G Sbjct: 40 EKRHKEDRDAWRLKDFANAIDKMSRAGYKGKHG 72 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,519,532 Number of Sequences: 27780 Number of extensions: 286172 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -