BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 7.0 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 9.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.2 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 7.0 Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 687 FRSNGHECGSPRFAGWLWFLRCLHLRSVFFLFRRFKLGRQRCTGHLRGVRRTDTLHQLL- 511 + +E P+ +GW +H F +++ + + GH R T +L Sbjct: 204 YTDKSNEKKIPKSSGWRKLRNIVHWTPFFQTYKKQRYPWVQLAGHQGNFRAGPTPGTILK 263 Query: 510 KLC 502 KLC Sbjct: 264 KLC 266 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +1 Query: 664 TLMPITPENLARIAR 708 +L+P +PEN A +AR Sbjct: 343 SLLPYSPENQAVVAR 357 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 254 PPARNEAPVSLLEYRKIPSLKGKSLLKSNQTDAESDPK 367 PP R PV Y +K ++++S ++ + DP+ Sbjct: 1648 PPNRKLPPVPGSNYNTCDRIKRGTVIRSIRSHSTWDPR 1685 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 9.2 Identities = 14/63 (22%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 687 FRSNGHECGSPRFAGWLWFLRCLHLRSVFFLFRRFKLGRQRCTGHLRGVRRTDTLHQLL- 511 ++ N G + +GW +H F +++ + + GH R T +L Sbjct: 119 YQRNPSVVGRKKSSGWRKLRNIVHWTPFFQTYKKQRYPWVQLAGHQGNFRAGPTPGTILK 178 Query: 510 KLC 502 KLC Sbjct: 179 KLC 181 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,836 Number of Sequences: 438 Number of extensions: 4038 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -