BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20253 (742 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38890.1 68418.m04703 exoribonuclease-related similar to SP|P... 29 4.3 At3g23020.1 68416.m02902 pentatricopeptide (PPR) repeat-containi... 27 9.9 >At5g38890.1 68418.m04703 exoribonuclease-related similar to SP|P53859 3'-5' exoribonuclease CSL4 (EC 3.1.13.-) {Saccharomyces cerevisiae} Length = 191 Score = 28.7 bits (61), Expect = 4.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -3 Query: 737 APVDRHCVGSRAIRAKFSGVM 675 A VD CVGS+A+R F+GV+ Sbjct: 85 AAVDILCVGSKAVRENFAGVI 105 >At3g23020.1 68416.m02902 pentatricopeptide (PPR) repeat-containing protein low similarity to leaf protein [Ipomoea nil] GI:3107905; contains Pfam profile PF01535: PPR repeat Length = 842 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 415 EK*KQTFASGA-DSDKHSQRSREEGHTECDT*LQQLVKG 528 +K KQ + G +SDK QRS G C T ++V G Sbjct: 34 KKLKQNYVPGTHESDKGPQRSTRNGDRGCGTVAHEVVAG 72 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,022,859 Number of Sequences: 28952 Number of extensions: 278181 Number of successful extensions: 622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -