BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20249 (813 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.9 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.8 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.8 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/43 (25%), Positives = 18/43 (41%) Frame = +3 Query: 99 EYPKCFIVGADNVGSQQMQQIRISLRGSSIVLMGKNTMMRKAI 227 EYPKC+ V + + +R S KN ++ A+ Sbjct: 2443 EYPKCWQVDCNKGPDSDKEAFAAFVRELSAAFKPKNLLLSAAV 2485 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 692 LATPAWNLARRSSGLMSRISGAKIVPESYTCLTT 591 L+TP+ + A +SSGL S +S + P TT Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTT 162 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 66 NYFVKIIQLLDEYPKCF 116 N KI L+DE+ +CF Sbjct: 214 NLHNKICNLIDEFNECF 230 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 8.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 223 PSKTTWTTIQPRETVATHQGQRW 291 P+ +TW+T+Q TV + W Sbjct: 302 PTYSTWSTVQTPTTVMSPTINCW 324 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.8 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +3 Query: 378 LPHCQSSFPPTTPASVQRK-PLSSKLFPSLPKFQRVLLKSSTM 503 +P Q + P Q K PLSS +PS+ ++L+ S M Sbjct: 1 MPLLQETTPKRDMLDSQEKTPLSSVSYPSMFTPSQLLMASHLM 43 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,015 Number of Sequences: 336 Number of extensions: 4777 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22206566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -