BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20247 (811 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0984 - 21432119-21432157,21432722-21434068 29 4.4 11_06_0382 - 22943583-22943710,22944283-22944397 28 7.6 >04_03_0984 - 21432119-21432157,21432722-21434068 Length = 461 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -1 Query: 394 YYTHVRPEQHEYCPRRMRERTLILIDHAQTQQGDAVPPGGHNEKRRY 254 Y+ V HE P ER I DH + DAV H +RR+ Sbjct: 369 YFAAVFDSLHECLPADSAERLAIERDHLGREIADAVASLDHQHRRRH 415 >11_06_0382 - 22943583-22943710,22944283-22944397 Length = 80 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/32 (31%), Positives = 21/32 (65%) Frame = +2 Query: 314 VVNKYKSPFSHAAWAVFVLLWSYMCIILVSVH 409 ++ + +SP HAA +FV ++ Y C++ V ++ Sbjct: 7 LLGEARSPKQHAAGTIFVNVYGYGCVVNVRLY 38 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,463,959 Number of Sequences: 37544 Number of extensions: 391506 Number of successful extensions: 807 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -