BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20244 (797 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 66 9e-13 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 26 1.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 3.6 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 6.3 AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding pr... 23 8.3 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 8.3 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 66.5 bits (155), Expect = 9e-13 Identities = 37/92 (40%), Positives = 55/92 (59%) Frame = +3 Query: 492 ITETVYAAIQGSCLGGGLETALACKYRIAVKDSKTGFGLPEVMLGLLPGGGGTQRLPALT 671 I + + AI G C+ GGLE AL C R+ +++ GF + L+ GG T RLPAL Sbjct: 138 IRKPLVCAITGYCVAGGLELALMCDLRVMEENAVLGFFNRRFGVPLIDGG--TVRLPALI 195 Query: 672 SIPTTLDLALTGKTVKADKAKKLGIVDLLVSL 767 + LDL LTG+TV A +A +G+V+ +V++ Sbjct: 196 GLSRALDLILTGRTVTAKEALDIGLVNRVVAV 227 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.8 bits (54), Expect = 1.6 Identities = 15/55 (27%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 344 SGIEAAVIISGKPGCFIAGADIS-MIENCKTKEEVVS--LSKRGHEIFRRIDNHG 499 +G + ++ + K G ++AGADI MI + K+K V+ + ++ I+ + +G Sbjct: 226 AGSGSLLVAAAKFGAYVAGADIDYMIVHGKSKPTRVNQKVREKDESIYANLQQYG 280 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 601 LDYQKSCWDFCPAVEGHRDYLLSP 672 L YQK C P GH LSP Sbjct: 163 LQYQKICGSNIPQASGHSKNSLSP 186 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -2 Query: 625 PNMTSGSPNPVLESFTAMRYLHARAVSNPPPRQLP 521 P+ S +PV + +LH A PPP P Sbjct: 802 PHSALSSHSPVGAGSHHLHHLHHHAAQQPPPGSHP 836 >AY146744-1|AAO12104.1| 176|Anopheles gambiae odorant-binding protein AgamOBP8 protein. Length = 176 Score = 23.4 bits (48), Expect = 8.3 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 601 NPVLESFTAMRYLHARAVSNPPPRQLP--CIAAYTVSVIVDSSEY 473 N ++E +R +R + PP C+ AYT + S+EY Sbjct: 129 NAIVEDPDDIRSETSRCLREPPAPDSGGGCLRAYTFFACIQSTEY 173 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 649 VPPPPGKSPNMTSGSPN 599 +PP P P+MTS +P+ Sbjct: 348 IPPAPNMWPSMTSQTPS 364 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,916 Number of Sequences: 2352 Number of extensions: 16897 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -