BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20244 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 27 0.20 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 7.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.6 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 27.1 bits (57), Expect = 0.20 Identities = 12/56 (21%), Positives = 31/56 (55%) Frame = +2 Query: 257 LDSPNVKVNSLNTQVMEEVSNIVNEIETNSGIEAAVIISGKPGCFIAGADISMIEN 424 L + + +NS+ + + ++++ +I TN+ + A I GKP + + S++++ Sbjct: 859 LPASSTSINSITVE-KDVINDVKTQITTNTPAKKATNIGGKPVAVVKSSAQSLLQS 913 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 138 KILRSRKELFISGVHSRKYAV 200 ++LR RKELFI+ V Y + Sbjct: 409 RLLRKRKELFIAIVCFVSYLI 429 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 138 KILRSRKELFISGVHSRKYAV 200 ++LR RKELFI+ V Y + Sbjct: 462 RLLRKRKELFIAIVCFVSYLI 482 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,200 Number of Sequences: 438 Number of extensions: 5028 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -