BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20243 (779 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022973-8|AAC25801.1| 116|Caenorhabditis elegans Hypothetical ... 40 0.002 Z83125-10|CAB05625.1| 459|Caenorhabditis elegans Hypothetical p... 28 6.5 >AF022973-8|AAC25801.1| 116|Caenorhabditis elegans Hypothetical protein F25G6.8 protein. Length = 116 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Frame = +2 Query: 134 LSNDEFLAELTKLFQKARLAG--SITMTMKRYDGRSKPQPR 250 + ND+FL +LT ++ +++ G S+ +TMK YDGR+K P+ Sbjct: 8 IPNDQFLQKLTAFYRDSKIRGPKSVYVTMKPYDGRTKAMPK 48 >Z83125-10|CAB05625.1| 459|Caenorhabditis elegans Hypothetical protein T15D6.12 protein. Length = 459 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 240 GLLRPSYLFIVIVIDPANRAFWKSFVNSAKNSSLLNKTIV 121 G P Y+F VID A + +SF +S K++ + + T++ Sbjct: 324 GTAAPKYVFNATVIDIAQTHWVRSFTDSTKHTKVSDGTLL 363 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,014,802 Number of Sequences: 27780 Number of extensions: 302269 Number of successful extensions: 632 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 632 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -