BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20243 (779 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43640.1 68415.m05424 signal recognition particle 14 kDa fami... 43 3e-04 >At2g43640.1 68415.m05424 signal recognition particle 14 kDa family protein / SRP14 family protein similar to SP|P16254 Signal recognition particle 14 kDa protein (SRP14) {Mus musculus}; contains Pfam profile: PF02290 signal recognition particle 14kD protein Length = 121 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 125 MVLLSNDEFLAELTKLFQKARLAGSITMTMKRYDGRSKPQPR 250 MVLL D FL ELT +F+K++ GS+ +T+KR +SK Q R Sbjct: 1 MVLLQLDPFLNELTSMFEKSKEKGSVWVTLKRSSLKSKVQKR 42 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 277 EYKCLLRAQSKSKKISTVVEQRDVEKFSTAYSNLLK 384 EY+CL+RA K +ST V +D ++F +Y+ +LK Sbjct: 52 EYRCLIRATDGKKTVSTSVGAKDHQRFQASYATILK 87 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,762,272 Number of Sequences: 28952 Number of extensions: 267677 Number of successful extensions: 563 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1746037600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -