BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20242 (744 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0433 - 29311749-29311859,29311958-29312116,29312208-293123... 28 9.0 >01_06_0433 - 29311749-29311859,29311958-29312116,29312208-29312315, 29312449-29312531,29312617-29312786,29312833-29312903, 29313170-29313302,29313483-29313749,29313865-29313969, 29314053-29314144,29314263-29314363,29314426-29314552, 29315025-29315140,29315222-29315291,29315476-29315685 Length = 640 Score = 27.9 bits (59), Expect = 9.0 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 250 RLGLKNTIYAMKYTIIQREYTF*SRLIYKLL-NL*SNIFYKLNYYY 116 R+G K ++ +KY Q E + L+YK+L NL N LNY Y Sbjct: 379 RIGGKVSVTLIKYENNQGEQSSADSLVYKVLENLIENSIPYLNYSY 424 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,878,198 Number of Sequences: 37544 Number of extensions: 266403 Number of successful extensions: 427 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1968901276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -