BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20242 (744 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 24 4.3 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 24 5.7 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 24.2 bits (50), Expect = 4.3 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +1 Query: 232 YFLSQVFLIFQCTCISTVKKNHLHCRHINMSCKR-VSAKFQIPVIVVIYLTKGLGT 396 Y + V+++F S++ + +H R+ MS ++ + F +P+ +I LT LGT Sbjct: 297 YGIPAVYVLFSYA--SSIDRFEVH-RYCWMSIQKGMIVSFMVPISFLIILTTVLGT 349 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = -3 Query: 472 FNLIV--MSTSFSNVE*TVIKLYKINARFPNPW 380 FNL + M+T SN+ +I+ Y N + +PW Sbjct: 8 FNLTLDNMTTLSSNIRQGLIEQYSNNRKVADPW 40 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,146 Number of Sequences: 2352 Number of extensions: 13787 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76507752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -