BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20240 (788 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 25 2.7 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 23 8.1 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 146 PLDLTELNIEKLP--IQFVAPYHSDEYHEVLRHESDLPHQYPVSLS 277 PLD ++ E+ ++ V P E HE L +E+D+P ++S Sbjct: 52 PLDEEDIRTEQPTSCVEEVLPTDPLELHEKLENETDIPRMVVQNIS 97 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 23.4 bits (48), Expect = 8.1 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -1 Query: 260 IDGVNQTRVLKLHDIRHCGMVPQIE*AIFQCLTQSSQEE 144 +D + + V ++ RHCGM I T S +EE Sbjct: 279 VDAIGMSTVHEIITARHCGMTCFAFSLITNMCTMSYEEE 317 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,493 Number of Sequences: 2352 Number of extensions: 13732 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -