BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20237 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 24 1.3 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 24 1.3 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 24 1.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 23 3.0 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 5.2 U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor prot... 21 9.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 9.1 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 16 RLIVLFIAFDSNNTLISRFTVTSSVIKHRPRQPCRCE*YKCGD 144 R I L +D++ I + V++ + R+P C+ KCGD Sbjct: 102 RHITLHHCYDADG--IKLMNEENGVMEIKIREPVECKCIKCGD 142 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 16 RLIVLFIAFDSNNTLISRFTVTSSVIKHRPRQPCRCE*YKCGD 144 R I L +D++ I + V++ + R+P C+ KCGD Sbjct: 102 RHITLHHCYDADG--IKLMNEENGVMEIKIREPVECKCIKCGD 142 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 347 R*DVFTRHPGHGWPGRVFGDERPI 418 R +V R PG WPG +RPI Sbjct: 908 RSNVTPRSPGRAWPGDSDIRQRPI 931 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 332 FTVRILYRGIVFVHEVILYQLYSQ 261 +T L G V VH+ + YQLY + Sbjct: 417 YTPSSLELGEVAVHDPVFYQLYKK 440 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 212 VILRDIQNIFSHNVTALENNAPESPHL 132 +++RD + + E P SPHL Sbjct: 94 ILIRDFSKFANRGLGVFERTEPLSPHL 120 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 417 YMRTGEGFLLVFAVNSAKSFEDIGS 491 Y+ EGF L+ NS SF+ + S Sbjct: 202 YIGDNEGFALIIYNNSDNSFQRLTS 226 >U15955-1|AAA67443.1| 95|Apis mellifera defensin precursor protein. Length = 95 Score = 21.4 bits (43), Expect = 9.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 178 CEKIFCISRKMTEYK 222 CEK+ CI RK T +K Sbjct: 74 CEKVGCICRK-TSFK 87 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 253 YQRLPHPQPPICTRSSCEIYKIFF 182 +Q L +PP +SSCEI +F Sbjct: 137 HQGLVEWKPPAIYKSSCEIDVEYF 160 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = -2 Query: 472 LLALLTANTSKNPSPVRMYWSLIAEYS 392 ++ +L + S NP R+Y L++ Y+ Sbjct: 11 IVLVLISGCSGNPDAKRLYDDLLSNYN 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,413 Number of Sequences: 438 Number of extensions: 5757 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -