BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20236 (578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 8e-42 SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.51 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 31 0.51 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) 29 2.1 SB_20635| Best HMM Match : rve (HMM E-Value=0.91) 29 2.7 SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_52533| Best HMM Match : rve (HMM E-Value=2) 29 2.7 SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) 29 2.7 SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) 29 2.7 SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) 28 4.8 SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 4.8 SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_12505| Best HMM Match : FHA (HMM E-Value=0.097) 28 6.3 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 167 bits (405), Expect = 8e-42 Identities = 82/93 (88%), Positives = 88/93 (94%), Gaps = 1/93 (1%) Frame = +1 Query: 232 QTREHL-LVSLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 408 +T EH+ L SLPIKEFEIIDFFLG +L DEVLKIMPVQKQTRAGQRTRFKAFVAIGD+NG Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDSNG 83 Query: 409 HIGLGVKCSKEVATAIRGAIILAKLSVLPVRRG 507 H+GLGVKCSKEVATAIRGAIILAKLSV+PVRRG Sbjct: 84 HVGLGVKCSKEVATAIRGAIILAKLSVIPVRRG 116 Score = 56.4 bits (130), Expect = 2e-08 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +3 Query: 507 FWGNKIGKPHTVPCKVTGKCGS 572 +WGNKIGKPHTVPCKVTGKCGS Sbjct: 117 YWGNKIGKPHTVPCKVTGKCGS 138 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +2 Query: 182 WVPVTKLGRLVREGKIDKLESIYLF 256 WVPVTKLGRLV++ KI LE IYLF Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLF 32 >SB_53557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 31.5 bits (68), Expect = 0.51 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 483 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 304 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 235 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 292 Query: 303 RAEEEI 286 R ++E+ Sbjct: 293 RNQDEL 298 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 31.5 bits (68), Expect = 0.51 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = -3 Query: 483 QLSKDNSASNGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL*NLIIQG 304 ++ + NS N D TNMT + + G CL + TC+ L DL NL+ + Sbjct: 519 RILRRNSQPNDQADVARLQSLITNMTEIYSTGKVCL-NITRNNTCMSL-DPDLGNLMSRS 576 Query: 303 RAEEEI 286 R ++E+ Sbjct: 577 RNQDEL 582 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 387 CHWRQQRSYWFGCEVQQGSRHCHSRRYYP-C*VVCFTSSKRFWGNK 521 C R + + C + G + CH Y P C V C ++S F NK Sbjct: 677 CEARNDSTGHYSCNLTNGQKVCHRDWYGPFCDVNCNSNSSHFTCNK 722 Score = 27.9 bits (59), Expect = 6.3 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Frame = +3 Query: 330 HACTETNTCRTAHT-FQGICCHWR-QQRSYWFGCEVQQGSRHCHSRRYYP-C*VVC-FTS 497 ++C TN + H + G C S F C G+R CHS Y C V C S Sbjct: 687 YSCNLTNGQKVCHRDWYGPFCDVNCNSNSSHFTCNKTTGARVCHSNWYGTYCDVYCNSNS 746 Query: 498 SKRFWGNK 521 S F NK Sbjct: 747 SSHFACNK 754 >SB_53780| Best HMM Match : RVT_1 (HMM E-Value=0.0007) Length = 280 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = -3 Query: 456 NGSGDFLAALHTQTNMTVVVANGNKCLETCALSGTCLFLYRHDL 325 N G LA + N+ +V NG K + C LS T L LY HDL Sbjct: 108 NAYGKSLAEFYNSNNL--IVLNGVK--QGCMLSPTLLNLYVHDL 147 >SB_20635| Best HMM Match : rve (HMM E-Value=0.91) Length = 748 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 155 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 192 >SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 811 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 848 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 2008 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 2045 >SB_52533| Best HMM Match : rve (HMM E-Value=2) Length = 212 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 95 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 132 >SB_25521| Best HMM Match : NLPC_P60 (HMM E-Value=5.7) Length = 212 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 9 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 46 >SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33) Length = 735 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 310 NDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLG 423 N +LK++ + Q +A + F+ FVA + H G G Sbjct: 532 NRSILKVLKIATQEKADMQREFRKFVAAYRSTPHTGTG 569 >SB_32523| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-17) Length = 1130 Score = 28.3 bits (60), Expect = 4.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +3 Query: 360 TAHTFQGICCHWRQQRSYW 416 TA + ICCH +Q + +W Sbjct: 486 TADQYDAICCHTQQSKKFW 504 >SB_32282| Best HMM Match : Laminin_G_2 (HMM E-Value=0) Length = 897 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +1 Query: 358 GQRTRFKAFVAIGDNNGHIGLGVKCSKEVA 447 G++ + K F+A+G NGH+ C ++A Sbjct: 356 GRKDKRKDFLALGLRNGHVEFRFSCGADIA 385 >SB_33388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/46 (23%), Positives = 24/46 (52%) Frame = -1 Query: 299 PRKKSMISNSLIGKETSKCSRVCRFFLREQDGRVW*QEPTLSGLPC 162 PR +++ N+L+G +C +V + + +++ V P + PC Sbjct: 299 PRPSTVLHNTLVGVGIGECRKVFCYDVEDKETYVLPDLPQVQAFPC 344 >SB_12505| Best HMM Match : FHA (HMM E-Value=0.097) Length = 629 Score = 27.9 bits (59), Expect = 6.3 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +1 Query: 340 QKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVLPVRRGSGVT 519 +KQT Q+ R KA +G + G+GV+ +K + + +L V ++ S V Sbjct: 56 EKQTEKIQQERHKALEDMGISIQSSGIGVEKNKFYLVNLNADPAMNELLVYYLKEHSKVG 115 Query: 520 RSE-SHTPSL 546 R + +HTP + Sbjct: 116 RLDANHTPDI 125 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,109,337 Number of Sequences: 59808 Number of extensions: 384941 Number of successful extensions: 1051 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1385833362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -