BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20236 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical prote... 24 3.1 AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosens... 24 3.1 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 24 4.1 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 24 4.1 AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CY... 23 7.2 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 7.2 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.2 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 7.2 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 9.5 >AJ973474-1|CAJ01521.1| 191|Anopheles gambiae hypothetical protein protein. Length = 191 Score = 24.2 bits (50), Expect = 3.1 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 332 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 505 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ697734-1|CAG26927.1| 191|Anopheles gambiae putative chemosensory protein CSP5 protein. Length = 191 Score = 24.2 bits (50), Expect = 3.1 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 332 CLYRNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCLFYQFEE 505 CL K P + +LP A T AR SP+ E L +++ L+Y + + Sbjct: 53 CLLSRKPCPPEGKDLKRILPEALRT-------KCARCSPIQKENALKIITRLYYDYPD 103 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 23.8 bits (49), Expect = 4.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -1 Query: 350 VCFCTGMIFRTSSFRDGPRKKSMISNSLIGKETSK 246 VC + RTSSF P +++ +IG +T++ Sbjct: 76 VCCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTE 110 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.8 bits (49), Expect = 4.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 399 QQRSYWFGCEVQQGSRHCHSRR 464 ++R+YW+ E+ Q HC R Sbjct: 268 RRRAYWWTTEIAQCRSHCIEAR 289 >AY341167-1|AAR13731.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341166-1|AAR13730.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341165-1|AAR13729.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341164-1|AAR13728.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341163-1|AAR13727.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY341162-1|AAR13726.1| 192|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 192 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 155 IVRHDMINLLMQARKQE 171 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 7.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 271 EFEIIDFFLGPSLNDEVLKIMPV 339 + E ID F G L+ + LKI P+ Sbjct: 29 KLEYIDLFKGGHLSSDYLKINPL 51 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 7.2 Identities = 21/82 (25%), Positives = 30/82 (36%) Frame = +3 Query: 327 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 506 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1805 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1863 Query: 507 FWGNKIGKPHTVPCKVTGKCGS 572 + + P T TG S Sbjct: 1864 I--SSMTVPATSSVSTTGGSSS 1883 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 7.2 Identities = 21/82 (25%), Positives = 30/82 (36%) Frame = +3 Query: 327 DHACTETNTCRTAHTFQGICCHWRQQRSYWFGCEVQQGSRHCHSRRYYPC*VVCFTSSKR 506 DHA T TC+T + G+ H + F E + H R Y +C +R Sbjct: 1806 DHAVTRCTTCQTVF-WIGLRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQR 1864 Query: 507 FWGNKIGKPHTVPCKVTGKCGS 572 + + P T TG S Sbjct: 1865 I--SSMTVPATSSVSTTGGSSS 1884 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 342 LYRHDL*NLIIQGRAEE 292 + RHD+ NL++Q R +E Sbjct: 275 IVRHDMINLLMQARKQE 291 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 22.6 bits (46), Expect = 9.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 543 GRCVAFRSCYP 511 G+CV FR C P Sbjct: 39 GKCVLFRECQP 49 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,241 Number of Sequences: 2352 Number of extensions: 11541 Number of successful extensions: 34 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -