BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20221 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 23 3.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 3.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 3.2 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 7.3 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 9.6 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 632 GWHGDNMFGAFNQMPWSRDAV 694 GW + FN PWS V Sbjct: 306 GWQNTDFVVCFNAKPWSNYCV 326 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 662 RLQTCCLRAIQKWARKRQQLGCSQSS*CMRIL 567 R + CC A+ RQ + S+ C+R + Sbjct: 611 RSRRCCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -2 Query: 662 RLQTCCLRAIQKWARKRQQLGCSQSS*CMRIL 567 R + CC A+ RQ + S+ C+R + Sbjct: 503 RSRRCCYHAVAPGTDIRQSIALSRKKKCIRYM 534 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -3 Query: 679 PRHLVEGSKHVVSV 638 P H + GSKH+ S+ Sbjct: 75 PNHPLSGSKHLCSI 88 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 335 QRFHQEHDHRNLS 373 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,675 Number of Sequences: 336 Number of extensions: 3813 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -