BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20219 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 5.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.3 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.3 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 5.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 7.0 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 9.2 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 9.2 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 88 KLSNTGKIITNYVVLLKDE 32 ++ G+I+TNY+ + DE Sbjct: 32 RILQNGRILTNYIKCMLDE 50 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 442 SKSQFSYSISICGLTTDGSILMIESSTMENFFCLS 338 S S SY IC LT + + + T N F LS Sbjct: 513 SLSDGSYFGEICLLTNARRVASVRAETYCNLFSLS 547 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 442 SKSQFSYSISICGLTTDGSILMIESSTMENFFCLS 338 S S SY IC LT + + + T N F LS Sbjct: 481 SLSDGSYFGEICLLTNARRVASVRAETYCNLFSLS 515 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 88 KLSNTGKIITNYVVLLKDE 32 ++ G+I+TNY+ + DE Sbjct: 32 RILQNGRILTNYIKCMLDE 50 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 283 KIYFFRMCVLLYASVMPKITSGGPI 209 K++ R + ASV P++ SG P+ Sbjct: 566 KVHGIRGLRVADASVQPQVISGNPV 590 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/17 (58%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -2 Query: 705 LREF*Y-ILECSLQIET 658 L+E Y I+ECSL +ET Sbjct: 144 LKEMFYLIIECSLNLET 160 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +2 Query: 419 AVAKLAFGEDSPVIKNKSNCTVQTLSGTGASALDSSS 529 AVA AFG S ++ + + + A+A+D+++ Sbjct: 106 AVAAAAFGATSSMVPGFGSTAASSAALAAAAAVDAAT 142 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,090 Number of Sequences: 438 Number of extensions: 5538 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -