BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20218 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 1.6 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 8.7 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.4 bits (53), Expect = 1.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 421 ICEHSIFVDNSSSKFGGLWKNIYRCHLSSSLHFEMF 314 + E + ++N S + LW+NI+R LSS +F Sbjct: 926 LLEPKVSLENPSVNWRLLWRNIHRSCLSSLQRSTLF 961 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 8.7 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 150 QNKHGKQGVQQGPLKAKPQVMDARNKIISKKRIQIQMLETNWLN 281 Q K+ G+QQ P + MD + ++R Q+Q E N LN Sbjct: 687 QPKYRSYGLQQKPPRYLQVSMDELKRHTQQRREQLQR-ELNELN 729 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,381 Number of Sequences: 2352 Number of extensions: 11130 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -