BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20217 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 1.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 23 2.6 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 2.6 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 22 4.6 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 704 VCQFNRSLGFFCDCTSKSN 648 VC+ + G+ CDC S +N Sbjct: 390 VCRISDGGGYICDCPSGTN 408 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 219 LLFVASSFN*FHKFCFITIILNYSSKII*LHL 314 LL A SF + F+ +L S KI+ LHL Sbjct: 245 LLMFAVSFLIITQVIFVICVLVQSEKIVWLHL 276 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +2 Query: 614 QTNYQTIIMARHLILRCSHRKILMSD*IDRLLNAYPYTHLS 736 Q+ + +++ R L ++ S +LN Y Y+HLS Sbjct: 214 QSTCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLS 254 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 216 YLLFVASSFN*FHKFCFITIILNYSSKII*LHLFLGKFKLNLILMMKS 359 Y L + +N + FC I + LN + I +L KF+ I+ +S Sbjct: 322 YHLEIEKYYNILY-FCRIMVYLNSAINPILYNLMSSKFRTGFIICSES 368 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,051 Number of Sequences: 336 Number of extensions: 3032 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -