BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20217 (754 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88175-7|AAS19859.1| 168|Caenorhabditis elegans Hypothetical pr... 35 0.071 Z77670-2|CAB01250.1| 588|Caenorhabditis elegans Hypothetical pr... 29 4.7 AJ512335-1|CAD54509.1| 588|Caenorhabditis elegans trehalase pro... 29 4.7 >U88175-7|AAS19859.1| 168|Caenorhabditis elegans Hypothetical protein F21F3.7 protein. Length = 168 Score = 34.7 bits (76), Expect = 0.071 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 11 FLPGAYHIRIAYCAYKQYPGYSFTDIPEFD 100 F+PG YH+ C PGYSF +P F+ Sbjct: 138 FIPGFYHVYYVTCTLCGRPGYSFDKLPTFN 167 >Z77670-2|CAB01250.1| 588|Caenorhabditis elegans Hypothetical protein W05E10.4 protein. Length = 588 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 578 HSCD--NPNISSMYCSTPLLVIVTRHSL 501 H CD N N S +YC+ P+L V HSL Sbjct: 27 HVCDTTNSNNSFIYCNGPILDAVNYHSL 54 >AJ512335-1|CAD54509.1| 588|Caenorhabditis elegans trehalase protein. Length = 588 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -3 Query: 578 HSCD--NPNISSMYCSTPLLVIVTRHSL 501 H CD N N S +YC+ P+L V HSL Sbjct: 27 HVCDTTNSNNSFIYCNGPILDAVNYHSL 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,297,859 Number of Sequences: 27780 Number of extensions: 258202 Number of successful extensions: 428 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -