BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20217 (754 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29850.1 68417.m04249 expressed protein contains Pfam PF05915... 43 2e-04 At2g19350.1 68415.m02258 expressed protein 43 2e-04 At3g29170.1 68416.m03655 expressed protein contains Pfam PF05915... 34 0.088 At3g57200.1 68416.m06368 hypothetical protein 29 2.5 At1g78060.1 68414.m09096 glycosyl hydrolase family 3 protein sim... 28 5.8 At1g04650.1 68414.m00462 hypothetical protein 28 7.7 >At4g29850.1 68417.m04249 expressed protein contains Pfam PF05915: Eukaryotic protein of unknown function (DUF872) Length = 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = +2 Query: 11 FLPGAYHIRIAYCAYKQYPGYSFTDIP 91 F+PG Y+ RIAY AYK Y G+SF++IP Sbjct: 75 FIPGFYYTRIAYYAYKGYKGFSFSNIP 101 >At2g19350.1 68415.m02258 expressed protein Length = 103 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/27 (62%), Positives = 22/27 (81%) Frame = +2 Query: 11 FLPGAYHIRIAYCAYKQYPGYSFTDIP 91 F+PG Y+ RIAY AYK Y G+SF++IP Sbjct: 75 FIPGFYYTRIAYYAYKGYKGFSFSNIP 101 >At3g29170.1 68416.m03655 expressed protein contains Pfam PF05915: Eukaryotic protein of unknown function (DUF872) Length = 121 Score = 34.3 bits (75), Expect = 0.088 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 11 FLPGAYHIRIAYCAYKQYPGYSFTDIPEF 97 FLPG Y RIAY +++ GY F IP + Sbjct: 93 FLPGFYETRIAYYSWRGAEGYRFAAIPSY 121 >At3g57200.1 68416.m06368 hypothetical protein Length = 504 Score = 29.5 bits (63), Expect = 2.5 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 5/30 (16%) Frame = +1 Query: 496 KPRLCLVTITSKGVEQ-----YIEEILGLS 570 KPR+C+ T TS G+EQ Y +++G+S Sbjct: 113 KPRICITTSTSAGLEQTLPWIYFHKVIGVS 142 >At1g78060.1 68414.m09096 glycosyl hydrolase family 3 protein similar to xylosidase GI:2102655 from [Aspergillus niger] Length = 767 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -3 Query: 587 PVPHSCDNPNISS---MYCSTPLLVIVTRHSLGLLLTVANNINNILNHA 450 P PHSCD N ++ +C T L + L LT+ I+ ++N A Sbjct: 21 PPPHSCDPSNPTTKLYQFCRTDLPIGKRARDLVSRLTIDEKISQLVNTA 69 >At1g04650.1 68414.m00462 hypothetical protein Length = 936 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 Query: 192 ISLSLFSDYLLFVASSFN*FHKFCFIT 272 I L DYL F ASSF K CF+T Sbjct: 70 IFFQLLLDYLRFSASSFTAIGKTCFMT 96 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,072,006 Number of Sequences: 28952 Number of extensions: 223218 Number of successful extensions: 361 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -