BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20216 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0984 + 12947444-12947530,12949071-12949127,12949833-129499... 33 0.18 08_02_1084 - 24232968-24234779 30 2.2 05_07_0095 - 27659944-27660795,27660900-27661172,27661280-276613... 28 8.8 >03_02_0984 + 12947444-12947530,12949071-12949127,12949833-12949904, 12950050-12950112,12950955-12951131,12951503-12951628, 12951711-12951777,12952019-12952215,12952617-12952691, 12954524-12954554,12954714-12954802,12955120-12955188, 12955306-12955425,12955963-12956081,12956303-12956441, 12956538-12957038,12957293-12957592,12957694-12957875, 12958277-12958388,12958953-12959072 Length = 900 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 375 LTDCAIRMPEKCTIYATLVGLLNAKNYNFGGEFVDYIVKTFKENLKSGN 521 L CA ++P K + L+GL+N +N +F VD ++ L + N Sbjct: 31 LLQCADQLPHKIPFFGVLIGLINLENEDFSKGIVDTTHANLQDALHNEN 79 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +1 Query: 115 REKSKICDTHSDFIMNRRRGHDDEEGYERLHRKRRRVSENQEIEDR 252 R++ + D D R R DD + Y HR R R SE E DR Sbjct: 534 RDRDRERDRERDRERERDRHRDDRDRYGDYHRHRDRDSERNEDWDR 579 >05_07_0095 - 27659944-27660795,27660900-27661172,27661280-27661354, 27661683-27661837,27661935-27662051,27662148-27662487 Length = 603 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 212 FRWRRSYPSSSSCPL 168 FRWRRS SSSS PL Sbjct: 15 FRWRRSTSSSSSSPL 29 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,802,701 Number of Sequences: 37544 Number of extensions: 338329 Number of successful extensions: 878 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -