BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20216 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) 28 6.8 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_25995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_9866| Best HMM Match : TP2 (HMM E-Value=0.27) Length = 1019 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +1 Query: 115 REKSKICDTHSDFIMNRRRGHDDEEGYERLHRKRRRVSENQEIEDRLSP 261 R S+ T S N RGH E G + K + VS +ED P Sbjct: 796 RNDSRYIPTESRSHPNESRGHLSESGSVQSKDKEKEVSTGASVEDAKRP 844 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 Query: 166 RRGHDDEEGYERLHRKRRRVSENQEIEDR 252 RR +DD EG ER R R V + EDR Sbjct: 639 RRPYDDPEGLERESRGERDVRRDDPREDR 667 >SB_25995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 945 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 727 RSFFSYNSDQPKVMLTAP-QIQPIPSDVRYSIFISRIY 617 +S F+Y P+V P + Q +PSD ++IF+S I+ Sbjct: 417 KSSFNYLLLDPRVSDNLPWRAQKLPSDEAFAIFVSAIF 454 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,021,530 Number of Sequences: 59808 Number of extensions: 406173 Number of successful extensions: 1157 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1157 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -