BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20214 (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 25 1.5 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 25 2.7 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 25 2.7 AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transpor... 24 3.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 4.6 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 23 6.1 AY752896-1|AAV30070.1| 105|Anopheles gambiae peroxidase 4A prot... 23 8.1 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 8.1 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 25.4 bits (53), Expect = 1.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 330 YGVQLLLNWSWT 365 YGVQL+ W WT Sbjct: 546 YGVQLMRRWKWT 557 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.6 bits (51), Expect = 2.7 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +3 Query: 300 TEDAVLPLTLYGVQLLLNW----SWTPIFFGLKDFKLAFIEISVLSGAAVATT 446 +EDAVLPL+L ++ W + + L + +L F++ L G +V T+ Sbjct: 19 SEDAVLPLSLDVGTIMRPWIFQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTS 71 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.6 bits (51), Expect = 2.7 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = +3 Query: 300 TEDAVLPLTLYGVQLLLNW----SWTPIFFGLKDFKLAFIEISVLSGAAVATT 446 +EDAVLPL+L ++ W + + L + +L F++ L G +V T+ Sbjct: 19 SEDAVLPLSLDVGTIMRPWIFQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTS 71 >AF533894-1|AAM97679.1| 156|Anopheles gambiae ascorbate transporter protein. Length = 156 Score = 24.2 bits (50), Expect = 3.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 Query: 330 YGVQLLLNWSWT 365 YG+QL+ W WT Sbjct: 132 YGMQLMRRWKWT 143 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 4.6 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 550 DCSSRCSKKGSW 515 +CS +CSK G W Sbjct: 471 ECSEQCSKAGCW 482 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.4 bits (48), Expect = 6.1 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 140 AKNNPLAHPPTFGRIIEPSAGQFAITKSF 54 +K NP A F + E + G+ A K+F Sbjct: 89 SKGNPTAKAEAFADVCENNEGETACDKAF 117 >AY752896-1|AAV30070.1| 105|Anopheles gambiae peroxidase 4A protein. Length = 105 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +3 Query: 279 WEECDGFTEDAVLPLTLYGVQLLLNWSWTPIFFGLKDFKLA 401 W++ F + L + Y Q ++ + W PI+ G ++ + A Sbjct: 33 WDDETVFQQARKLNIAQY--QRIVYYEWLPIYLGAENMRAA 71 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 122 PMDCFLPVKSAKTAVKSPGMMN*RSQAGLP 211 PMD P+K K G+M + + G P Sbjct: 655 PMDQLKPIKGDKGEKGENGLMGIKGEKGFP 684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 762,749 Number of Sequences: 2352 Number of extensions: 17310 Number of successful extensions: 89 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -