BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20212 (699 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U17969-1|AAA86989.1| 154|Homo sapiens eIF-5A protein. 127 3e-29 M23419-1|AAA58453.1| 154|Homo sapiens initiation factor 4D prot... 127 3e-29 BC107779-1|AAI07780.1| 154|Homo sapiens eukaryotic translation ... 127 3e-29 BC085015-1|AAH85015.1| 154|Homo sapiens eukaryotic translation ... 127 3e-29 BC080196-1|AAH80196.1| 154|Homo sapiens EIF5A protein protein. 127 3e-29 BC030160-1|AAH30160.1| 154|Homo sapiens eukaryotic translation ... 127 3e-29 BC001832-1|AAH01832.1| 154|Homo sapiens eukaryotic translation ... 127 3e-29 BC000751-1|AAH00751.1| 154|Homo sapiens eukaryotic translation ... 127 3e-29 AY129322-2|AAN17518.1| 154|Homo sapiens eukaryotic initiation f... 127 3e-29 AY129321-1|AAN17516.1| 154|Homo sapiens eukaryotic initiation f... 127 3e-29 AY129320-1|AAN17515.1| 154|Homo sapiens eukaryotic initiation f... 127 3e-29 AY129319-1|AAN17514.1| 184|Homo sapiens eukaryotic initiation f... 127 3e-29 S72024-1|AAD14095.1| 154|Homo sapiens eif-5A protein. 122 1e-27 BC070048-1|AAH70048.1| 170|Homo sapiens EIF5AL1 protein protein. 122 1e-27 BC036072-1|AAH36072.1| 153|Homo sapiens eukaryotic translation ... 121 3e-27 AY205261-1|AAO18679.1| 153|Homo sapiens eukaryotic initiation f... 121 3e-27 AY205260-1|AAO18678.1| 153|Homo sapiens eukaryotic initiation f... 121 3e-27 AY205259-1|AAO18677.1| 153|Homo sapiens eukaryotic initiation f... 121 3e-27 AY205258-1|AAO18676.1| 153|Homo sapiens eukaryotic initiation f... 121 3e-27 AF293387-1|AAG23176.1| 153|Homo sapiens eukaryotic translation ... 121 3e-27 AF262027-1|AAF98810.1| 153|Homo sapiens eIF-5A2 protein. 121 3e-27 BC056900-1|AAH56900.1| 1504|Homo sapiens nischarin protein. 30 6.9 BC054494-1|AAH54494.1| 1504|Homo sapiens nischarin protein. 30 6.9 BC038102-1|AAH38102.1| 1504|Homo sapiens nischarin protein. 30 6.9 AL117432-1|CAB55920.1| 993|Homo sapiens hypothetical protein pr... 30 6.9 AF082516-1|AAC33104.1| 1504|Homo sapiens I-1 receptor candidate ... 30 6.9 AF058290-1|AAC33321.1| 595|Homo sapiens imidazoline receptor an... 30 6.9 AB023192-1|BAA76819.1| 1528|Homo sapiens KIAA0975 protein protein. 30 6.9 X14672-1|CAA32802.1| 290|Homo sapiens protein ( Human gene for ... 30 9.1 U53473-1|AAA98976.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 U23434-1|AAA64585.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 U23052-1|AAA64584.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 D90042-1|BAA14096.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 D90040-1|BAA14094.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 D10872-1|BAA01642.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 D10871-1|BAA01641.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 D10870-1|BAA01640.1| 290|Homo sapiens arylamine N-acetyltransfe... 30 9.1 DQ473267-1|ABF01665.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473266-1|ABF01664.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473265-1|ABF01663.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473264-1|ABF01662.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473263-1|ABF01661.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473262-1|ABF01660.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473261-1|ABF01659.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473260-1|ABF01658.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473259-1|ABF01657.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473258-1|ABF01656.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473257-1|ABF01655.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473256-1|ABF01654.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473255-1|ABF01653.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473254-1|ABF01652.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473253-1|ABF01651.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473252-1|ABF01650.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473251-1|ABF01649.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473250-1|ABF01648.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473249-1|ABF01647.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473248-1|ABF01646.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473247-1|ABF01645.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473246-1|ABF01644.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473245-1|ABF01643.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473244-1|ABF01642.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473243-1|ABF01641.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473242-1|ABF01640.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473241-1|ABF01639.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473240-1|ABF01638.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473239-1|ABF01637.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473238-1|ABF01636.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473237-1|ABF01635.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473236-1|ABF01634.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473235-1|ABF01633.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473234-1|ABF01632.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473233-1|ABF01631.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473232-1|ABF01630.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473231-1|ABF01629.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473230-1|ABF01628.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473229-1|ABF01627.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473228-1|ABF01626.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473227-1|ABF01625.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473226-1|ABF01624.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473225-1|ABF01623.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473224-1|ABF01622.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473223-1|ABF01621.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473222-1|ABF01620.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473221-1|ABF01619.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473220-1|ABF01618.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473219-1|ABF01617.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473218-1|ABF01616.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473217-1|ABF01615.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473216-1|ABF01614.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473215-1|ABF01613.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473214-1|ABF01612.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473213-1|ABF01611.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473212-1|ABF01610.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473211-1|ABF01609.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473210-1|ABF01608.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473209-1|ABF01607.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473208-1|ABF01606.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473207-1|ABF01605.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473206-1|ABF01604.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473205-1|ABF01603.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473204-1|ABF01602.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473203-1|ABF01601.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473202-1|ABF01600.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473201-1|ABF01599.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473200-1|ABF01598.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473199-1|ABF01597.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473198-1|ABF01596.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473197-1|ABF01595.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473196-1|ABF01594.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473195-1|ABF01593.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473194-1|ABF01592.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473193-1|ABF01591.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473192-1|ABF01590.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473191-1|ABF01589.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473190-1|ABF01588.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473189-1|ABF01587.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473188-1|ABF01586.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473187-1|ABF01585.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473186-1|ABF01584.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473185-1|ABF01583.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473184-1|ABF01582.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473183-1|ABF01581.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473182-1|ABF01580.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473181-1|ABF01579.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473180-1|ABF01578.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473179-1|ABF01577.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473178-1|ABF01576.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473177-1|ABF01575.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473176-1|ABF01574.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473175-1|ABF01573.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473174-1|ABF01572.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473173-1|ABF01571.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473172-1|ABF01570.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473171-1|ABF01569.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473170-1|ABF01568.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473169-1|ABF01567.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473168-1|ABF01566.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473167-1|ABF01565.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473166-1|ABF01564.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473165-1|ABF01563.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473164-1|ABF01562.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473163-1|ABF01561.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473162-1|ABF01560.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473161-1|ABF01559.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473160-1|ABF01558.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473159-1|ABF01557.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473158-1|ABF01556.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473157-1|ABF01555.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473156-1|ABF01554.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473155-1|ABF01553.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473154-1|ABF01552.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473153-1|ABF01551.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473152-1|ABF01550.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473151-1|ABF01549.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473150-1|ABF01548.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473149-1|ABF01547.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473148-1|ABF01546.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473147-1|ABF01545.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473146-1|ABF01544.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473144-1|ABF01542.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473143-1|ABF01541.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473142-1|ABF01540.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473141-1|ABF01539.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473140-1|ABF01538.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473139-1|ABF01537.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473138-1|ABF01536.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473137-1|ABF01535.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473136-1|ABF01534.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473135-1|ABF01533.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473134-1|ABF01532.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473132-1|ABF01530.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473131-1|ABF01529.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473130-1|ABF01528.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473129-1|ABF01527.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473128-1|ABF01526.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473127-1|ABF01525.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473126-1|ABF01524.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473125-1|ABF01523.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473124-1|ABF01522.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473123-1|ABF01521.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473122-1|ABF01520.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473121-1|ABF01519.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473120-1|ABF01518.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473119-1|ABF01517.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473118-1|ABF01516.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473117-1|ABF01515.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473116-1|ABF01514.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473115-1|ABF01513.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473114-1|ABF01512.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473113-1|ABF01511.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473112-1|ABF01510.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473111-1|ABF01509.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473110-1|ABF01508.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473109-1|ABF01507.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473108-1|ABF01506.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473107-1|ABF01505.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473106-1|ABF01504.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473105-1|ABF01503.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473104-1|ABF01502.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473103-1|ABF01501.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473102-1|ABF01500.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473101-1|ABF01499.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473100-1|ABF01498.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473099-1|ABF01497.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473098-1|ABF01496.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473097-1|ABF01495.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473096-1|ABF01494.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473095-1|ABF01493.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473094-1|ABF01492.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473093-1|ABF01491.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473092-1|ABF01490.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473091-1|ABF01489.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473090-1|ABF01488.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473089-1|ABF01487.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473088-1|ABF01486.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473087-1|ABF01485.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473086-1|ABF01484.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473085-1|ABF01483.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473084-1|ABF01482.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473083-1|ABF01481.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473082-1|ABF01480.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473081-1|ABF01479.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473080-1|ABF01478.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473079-1|ABF01477.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473078-1|ABF01476.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473077-1|ABF01475.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473076-1|ABF01474.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473075-1|ABF01473.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473074-1|ABF01472.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473073-1|ABF01471.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473072-1|ABF01470.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473071-1|ABF01469.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473070-1|ABF01468.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473069-1|ABF01467.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473068-1|ABF01466.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473067-1|ABF01465.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473066-1|ABF01464.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473065-1|ABF01463.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473064-1|ABF01462.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473063-1|ABF01461.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473062-1|ABF01460.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473061-1|ABF01459.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473060-1|ABF01458.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473059-1|ABF01457.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473058-1|ABF01456.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473057-1|ABF01455.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473056-1|ABF01454.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473055-1|ABF01453.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473054-1|ABF01452.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473053-1|ABF01451.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473052-1|ABF01450.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473051-1|ABF01449.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473050-1|ABF01448.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473049-1|ABF01447.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473048-1|ABF01446.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473047-1|ABF01445.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473046-1|ABF01444.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473045-1|ABF01443.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473044-1|ABF01442.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473043-1|ABF01441.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473042-1|ABF01440.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473041-1|ABF01439.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473040-1|ABF01438.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473039-1|ABF01437.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473038-1|ABF01436.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473037-1|ABF01435.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473036-1|ABF01434.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473035-1|ABF01433.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473034-1|ABF01432.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473033-1|ABF01431.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473032-1|ABF01430.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473031-1|ABF01429.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473030-1|ABF01428.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473029-1|ABF01427.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473028-1|ABF01426.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473027-1|ABF01425.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473026-1|ABF01424.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473025-1|ABF01423.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473023-1|ABF01421.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473022-1|ABF01420.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473021-1|ABF01419.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473020-1|ABF01418.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473019-1|ABF01417.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473018-1|ABF01416.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473017-1|ABF01415.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473016-1|ABF01414.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473015-1|ABF01413.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473014-1|ABF01412.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473013-1|ABF01411.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473012-1|ABF01410.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473011-1|ABF01409.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473010-1|ABF01408.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473009-1|ABF01407.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473008-1|ABF01406.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473007-1|ABF01405.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473006-1|ABF01404.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473005-1|ABF01403.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473004-1|ABF01402.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473003-1|ABF01401.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473002-1|ABF01400.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473001-1|ABF01399.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ473000-1|ABF01398.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472999-1|ABF01397.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472998-1|ABF01396.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472997-1|ABF01395.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472996-1|ABF01394.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472995-1|ABF01393.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472994-1|ABF01392.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472993-1|ABF01391.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472992-1|ABF01390.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472991-1|ABF01389.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472990-1|ABF01388.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472989-1|ABF01387.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472988-1|ABF01386.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472987-1|ABF01385.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472986-1|ABF01384.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472985-1|ABF01383.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472984-1|ABF01382.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472983-1|ABF01381.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472982-1|ABF01380.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472981-1|ABF01379.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472980-1|ABF01378.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472979-1|ABF01377.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472978-1|ABF01376.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472977-1|ABF01375.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472976-1|ABF01374.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472975-1|ABF01373.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472974-1|ABF01372.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472973-1|ABF01371.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472972-1|ABF01370.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472971-1|ABF01369.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472970-1|ABF01368.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472969-1|ABF01367.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472968-1|ABF01366.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472967-1|ABF01365.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472966-1|ABF01364.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472965-1|ABF01363.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472964-1|ABF01362.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472963-1|ABF01361.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472962-1|ABF01360.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472961-1|ABF01359.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472960-1|ABF01358.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472959-1|ABF01357.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472958-1|ABF01356.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472957-1|ABF01355.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472956-1|ABF01354.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472955-1|ABF01353.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472954-1|ABF01352.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472953-1|ABF01351.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472952-1|ABF01350.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472951-1|ABF01349.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472950-1|ABF01348.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472949-1|ABF01347.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472948-1|ABF01346.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472947-1|ABF01345.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472946-1|ABF01344.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472945-1|ABF01343.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472944-1|ABF01342.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472943-1|ABF01341.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472942-1|ABF01340.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472941-1|ABF01339.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472940-1|ABF01338.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472939-1|ABF01337.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472938-1|ABF01336.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472937-1|ABF01335.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472936-1|ABF01334.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472935-1|ABF01333.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472934-1|ABF01332.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472933-1|ABF01331.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472932-1|ABF01330.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472931-1|ABF01329.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472930-1|ABF01328.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472929-1|ABF01327.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472928-1|ABF01326.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472927-1|ABF01325.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472926-1|ABF01324.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472925-1|ABF01323.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472924-1|ABF01322.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472923-1|ABF01321.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472922-1|ABF01320.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472921-1|ABF01319.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472920-1|ABF01318.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472918-1|ABF01316.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472917-1|ABF01315.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472916-1|ABF01314.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472915-1|ABF01313.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472914-1|ABF01312.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472913-1|ABF01311.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472912-1|ABF01310.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472911-1|ABF01309.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472910-1|ABF01308.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472909-1|ABF01307.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472907-1|ABF01305.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472906-1|ABF01304.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472905-1|ABF01303.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472904-1|ABF01302.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472903-1|ABF01301.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472902-1|ABF01300.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472901-1|ABF01299.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472900-1|ABF01298.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472899-1|ABF01297.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472898-1|ABF01296.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472897-1|ABF01295.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472896-1|ABF01294.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472895-1|ABF01293.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472894-1|ABF01292.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472893-1|ABF01291.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472892-1|ABF01290.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472891-1|ABF01289.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472890-1|ABF01288.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472889-1|ABF01287.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472888-1|ABF01286.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472887-1|ABF01285.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472886-1|ABF01284.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472885-1|ABF01283.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472884-1|ABF01282.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472883-1|ABF01281.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472882-1|ABF01280.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472881-1|ABF01279.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472880-1|ABF01278.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472879-1|ABF01277.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472878-1|ABF01276.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472877-1|ABF01275.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472876-1|ABF01274.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472875-1|ABF01273.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472874-1|ABF01272.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472873-1|ABF01271.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472872-1|ABF01270.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472871-1|ABF01269.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472870-1|ABF01268.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472869-1|ABF01267.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472868-1|ABF01266.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472867-1|ABF01265.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472866-1|ABF01264.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472865-1|ABF01263.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472864-1|ABF01262.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472863-1|ABF01261.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472861-1|ABF01259.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472860-1|ABF01258.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472859-1|ABF01257.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472857-1|ABF01255.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472856-1|ABF01254.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472855-1|ABF01253.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472853-1|ABF01251.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472851-1|ABF01249.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472850-1|ABF01248.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472849-1|ABF01247.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472848-1|ABF01246.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472847-1|ABF01245.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472846-1|ABF01244.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472845-1|ABF01243.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472844-1|ABF01242.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472843-1|ABF01241.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472842-1|ABF01240.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472841-1|ABF01239.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472840-1|ABF01238.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472839-1|ABF01237.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472838-1|ABF01236.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472837-1|ABF01235.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472836-1|ABF01234.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472835-1|ABF01233.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472834-1|ABF01232.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472833-1|ABF01231.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472832-1|ABF01230.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472831-1|ABF01229.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472830-1|ABF01228.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472829-1|ABF01227.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472828-1|ABF01226.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472827-1|ABF01225.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472826-1|ABF01224.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472825-1|ABF01223.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472823-1|ABF01221.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472822-1|ABF01220.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472821-1|ABF01219.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472820-1|ABF01218.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472819-1|ABF01217.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472818-1|ABF01216.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472817-1|ABF01215.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472816-1|ABF01214.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472815-1|ABF01213.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472814-1|ABF01212.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472813-1|ABF01211.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472812-1|ABF01210.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472811-1|ABF01209.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472810-1|ABF01208.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472809-1|ABF01207.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472808-1|ABF01206.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472807-1|ABF01205.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472806-1|ABF01204.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472805-1|ABF01203.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472804-1|ABF01202.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472803-1|ABF01201.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472801-1|ABF01199.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472800-1|ABF01198.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472799-1|ABF01197.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472798-1|ABF01196.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472797-1|ABF01195.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472796-1|ABF01194.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472795-1|ABF01193.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 DQ472794-1|ABF01192.1| 290|Homo sapiens arylamine N-acetyltrans... 30 9.1 >U17969-1|AAA86989.1| 154|Homo sapiens eIF-5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >M23419-1|AAA58453.1| 154|Homo sapiens initiation factor 4D protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC107779-1|AAI07780.1| 154|Homo sapiens eukaryotic translation initiation factor 5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC085015-1|AAH85015.1| 154|Homo sapiens eukaryotic translation initiation factor 5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC080196-1|AAH80196.1| 154|Homo sapiens EIF5A protein protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC030160-1|AAH30160.1| 154|Homo sapiens eukaryotic translation initiation factor 5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC001832-1|AAH01832.1| 154|Homo sapiens eukaryotic translation initiation factor 5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC000751-1|AAH00751.1| 154|Homo sapiens eukaryotic translation initiation factor 5A protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >AY129322-2|AAN17518.1| 154|Homo sapiens eukaryotic initiation factor 5A isoform I variant D protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >AY129321-1|AAN17516.1| 154|Homo sapiens eukaryotic initiation factor 5A isoform I variant C protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >AY129320-1|AAN17515.1| 154|Homo sapiens eukaryotic initiation factor 5A isoform I variant B protein. Length = 154 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >AY129319-1|AAN17514.1| 184|Homo sapiens eukaryotic initiation factor 5A isoform I variant A protein. Length = 184 Score = 127 bits (307), Expect = 3e-29 Identities = 59/72 (81%), Positives = 63/72 (87%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 33 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 92 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 93 IFTGKKYEDICP 104 Score = 116 bits (279), Expect = 8e-26 Identities = 50/86 (58%), Positives = 68/86 (79%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++REDL++P+GDLG ++ Sbjct: 96 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVREDLRLPEGDLGKEIE 154 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 155 QKYDCGEEILITVLSAMTEEAAVAIK 180 >S72024-1|AAD14095.1| 154|Homo sapiens eif-5A protein. Length = 154 Score = 122 bits (294), Expect = 1e-27 Identities = 57/72 (79%), Positives = 61/72 (84%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKG PCKIVEMS SKTGKHGHAKVHLVGID Sbjct: 3 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 112 bits (269), Expect = 1e-24 Identities = 48/86 (55%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP+++R D+QL I D GYL+L+ D+G++ EDL++P+GDLG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIRRNDFQLIGIQD-GYLSLLQDSGEVPEDLRLPEGDLGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 125 QKYDCGEEILITVLSAMTEEAAVAIK 150 >BC070048-1|AAH70048.1| 170|Homo sapiens EIF5AL1 protein protein. Length = 170 Score = 122 bits (294), Expect = 1e-27 Identities = 57/72 (79%), Positives = 61/72 (84%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 +D FETGD+GASATFPMQCSALRKNGFV+LKG PCKIVEMS SKTGKHGHAKVHLVGID Sbjct: 19 DDLDFETGDAGASATFPMQCSALRKNGFVVLKGWPCKIVEMSASKTGKHGHAKVHLVGID 78 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 79 IFTGKKYEDICP 90 Score = 113 bits (272), Expect = 6e-25 Identities = 49/86 (56%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR D+QL I D GYL+L+ D+G++ EDL++P+GDLG ++ Sbjct: 82 GKKYEDICPSTHNMDVPNIKRNDFQLIGIQD-GYLSLLQDSGEVPEDLRLPEGDLGKEIE 140 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +D G+E+L TVL + EE +A K Sbjct: 141 QKYDCGEEILITVLSAMTEEAAVAIK 166 >BC036072-1|AAH36072.1| 153|Homo sapiens eukaryotic translation initiation factor 5A2 protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AY205261-1|AAO18679.1| 153|Homo sapiens eukaryotic initiation factor 5A isoform II protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AY205260-1|AAO18678.1| 153|Homo sapiens eukaryotic initiation factor 5A isoform II protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AY205259-1|AAO18677.1| 153|Homo sapiens eukaryotic initiation factor 5A isoform II protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AY205258-1|AAO18676.1| 153|Homo sapiens eukaryotic initiation factor 5A isoform II protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AF293387-1|AAG23176.1| 153|Homo sapiens eukaryotic translation initiation factor 5AII protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >AF262027-1|AAF98810.1| 153|Homo sapiens eIF-5A2 protein. Length = 153 Score = 121 bits (291), Expect = 3e-27 Identities = 55/72 (76%), Positives = 62/72 (86%) Frame = +3 Query: 69 EDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 248 ++ F TGD+GAS+T+PMQCSALRKNGFV+LKGRPCKIVEMSTSKTGKHGHAKVHLVGID Sbjct: 3 DEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 62 Query: 249 IFMVKSMKISVP 284 IF K + P Sbjct: 63 IFTGKKYEDICP 74 Score = 105 bits (253), Expect = 1e-22 Identities = 45/86 (52%), Positives = 67/86 (77%) Frame = +2 Query: 257 GKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNGDLREDLKIPDGDLGTQLR 436 GKKYEDICPSTHNMDVP++KR DYQL I DGYL+L+ + G++REDLK+P+G+LG ++ Sbjct: 66 GKKYEDICPSTHNMDVPNIKRNDYQLICI-QDGYLSLLTETGEVREDLKLPEGELGKEIE 124 Query: 437 TDFDSGKELLCTVLKSCGEECVIASK 514 +++G+++ +V+ + EE +A K Sbjct: 125 GKYNAGEDVQVSVMCAMSEEYAVAIK 150 >BC056900-1|AAH56900.1| 1504|Homo sapiens nischarin protein. Length = 1504 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 883 SCTLCSAVRRSCCAP--SEAVKSAAIP 907 >BC054494-1|AAH54494.1| 1504|Homo sapiens nischarin protein. Length = 1504 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 883 SCTLCSAVRRSCCAP--SEAVKSAAIP 907 >BC038102-1|AAH38102.1| 1504|Homo sapiens nischarin protein. Length = 1504 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 883 SCTLCSAVRRSCCAP--SEAVKSAAIP 907 >AL117432-1|CAB55920.1| 993|Homo sapiens hypothetical protein protein. Length = 993 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 372 SCTLCSAVRRSCCAP--SEAVKSAAIP 396 >AF082516-1|AAC33104.1| 1504|Homo sapiens I-1 receptor candidate protein protein. Length = 1504 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 883 SCTLCSAVRRSCCAP--SEAVKSAAIP 907 >AF058290-1|AAC33321.1| 595|Homo sapiens imidazoline receptor antisera-selected protein protein. Length = 595 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 415 SCTLCSAVRRSCCAP--SEAVKSAAIP 439 >AB023192-1|BAA76819.1| 1528|Homo sapiens KIAA0975 protein protein. Length = 1528 Score = 30.3 bits (65), Expect = 6.9 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +3 Query: 429 SCVLTSTAARNCCAPC*NPAVRSASSP 509 SC L S R+CCAP + AV+SA+ P Sbjct: 907 SCTLCSAVRRSCCAP--SEAVKSAAIP 931 >X14672-1|CAA32802.1| 290|Homo sapiens protein ( Human gene for arylamine N-acetyltransferase (EC 2.3.1.5). ). Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >U53473-1|AAA98976.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >U23434-1|AAA64585.1| 290|Homo sapiens arylamine N-acetyltransferase slow form protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >U23052-1|AAA64584.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >D90042-1|BAA14096.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >D90040-1|BAA14094.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >D10872-1|BAA01642.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >D10871-1|BAA01641.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >D10870-1|BAA01640.1| 290|Homo sapiens arylamine N-acetyltransferase protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473267-1|ABF01665.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473266-1|ABF01664.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473265-1|ABF01663.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473264-1|ABF01662.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473263-1|ABF01661.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473262-1|ABF01660.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473261-1|ABF01659.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473260-1|ABF01658.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473259-1|ABF01657.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473258-1|ABF01656.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473257-1|ABF01655.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473256-1|ABF01654.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473255-1|ABF01653.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473254-1|ABF01652.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473253-1|ABF01651.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473252-1|ABF01650.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473251-1|ABF01649.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473250-1|ABF01648.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473249-1|ABF01647.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473248-1|ABF01646.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473247-1|ABF01645.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473246-1|ABF01644.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473245-1|ABF01643.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473244-1|ABF01642.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473243-1|ABF01641.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473242-1|ABF01640.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473241-1|ABF01639.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473240-1|ABF01638.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473239-1|ABF01637.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473238-1|ABF01636.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473237-1|ABF01635.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473236-1|ABF01634.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473235-1|ABF01633.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473234-1|ABF01632.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473233-1|ABF01631.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473232-1|ABF01630.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473231-1|ABF01629.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473230-1|ABF01628.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473229-1|ABF01627.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473228-1|ABF01626.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473227-1|ABF01625.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473226-1|ABF01624.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473225-1|ABF01623.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473224-1|ABF01622.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473223-1|ABF01621.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473222-1|ABF01620.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473221-1|ABF01619.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473220-1|ABF01618.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473219-1|ABF01617.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473218-1|ABF01616.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473217-1|ABF01615.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473216-1|ABF01614.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473215-1|ABF01613.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473214-1|ABF01612.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473213-1|ABF01611.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473212-1|ABF01610.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473211-1|ABF01609.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473210-1|ABF01608.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473209-1|ABF01607.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473208-1|ABF01606.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473207-1|ABF01605.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473206-1|ABF01604.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473205-1|ABF01603.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473204-1|ABF01602.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473203-1|ABF01601.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473202-1|ABF01600.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473201-1|ABF01599.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473200-1|ABF01598.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473199-1|ABF01597.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473198-1|ABF01596.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473197-1|ABF01595.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473196-1|ABF01594.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473195-1|ABF01593.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473194-1|ABF01592.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473193-1|ABF01591.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473192-1|ABF01590.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473191-1|ABF01589.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473190-1|ABF01588.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473189-1|ABF01587.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473188-1|ABF01586.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473187-1|ABF01585.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473186-1|ABF01584.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473185-1|ABF01583.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473184-1|ABF01582.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473183-1|ABF01581.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473182-1|ABF01580.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473181-1|ABF01579.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473180-1|ABF01578.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473179-1|ABF01577.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473178-1|ABF01576.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473177-1|ABF01575.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473176-1|ABF01574.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473175-1|ABF01573.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473174-1|ABF01572.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473173-1|ABF01571.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473172-1|ABF01570.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473171-1|ABF01569.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473170-1|ABF01568.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473169-1|ABF01567.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473168-1|ABF01566.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473167-1|ABF01565.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473166-1|ABF01564.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473165-1|ABF01563.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473164-1|ABF01562.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473163-1|ABF01561.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473162-1|ABF01560.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473161-1|ABF01559.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473160-1|ABF01558.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473159-1|ABF01557.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473158-1|ABF01556.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473157-1|ABF01555.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473156-1|ABF01554.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473155-1|ABF01553.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473154-1|ABF01552.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473153-1|ABF01551.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473152-1|ABF01550.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473151-1|ABF01549.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473150-1|ABF01548.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNREFLNSHLLPKKKHQKIYLFTLE 195 >DQ473149-1|ABF01547.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473148-1|ABF01546.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473147-1|ABF01545.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473146-1|ABF01544.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473144-1|ABF01542.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473143-1|ABF01541.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473142-1|ABF01540.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473141-1|ABF01539.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473140-1|ABF01538.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473139-1|ABF01537.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473138-1|ABF01536.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473137-1|ABF01535.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473136-1|ABF01534.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473135-1|ABF01533.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473134-1|ABF01532.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473132-1|ABF01530.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473131-1|ABF01529.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473130-1|ABF01528.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473129-1|ABF01527.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473128-1|ABF01526.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473127-1|ABF01525.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473126-1|ABF01524.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473125-1|ABF01523.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473124-1|ABF01522.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473123-1|ABF01521.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473122-1|ABF01520.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473121-1|ABF01519.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473120-1|ABF01518.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473119-1|ABF01517.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473118-1|ABF01516.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473117-1|ABF01515.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473116-1|ABF01514.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473115-1|ABF01513.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473114-1|ABF01512.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473113-1|ABF01511.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473112-1|ABF01510.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473111-1|ABF01509.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473110-1|ABF01508.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473109-1|ABF01507.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473108-1|ABF01506.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473107-1|ABF01505.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473106-1|ABF01504.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473105-1|ABF01503.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473104-1|ABF01502.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473103-1|ABF01501.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473102-1|ABF01500.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473101-1|ABF01499.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473100-1|ABF01498.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473099-1|ABF01497.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473098-1|ABF01496.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473097-1|ABF01495.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473096-1|ABF01494.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473095-1|ABF01493.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473094-1|ABF01492.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473093-1|ABF01491.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473092-1|ABF01490.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473091-1|ABF01489.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473090-1|ABF01488.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473089-1|ABF01487.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473088-1|ABF01486.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473087-1|ABF01485.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473086-1|ABF01484.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473085-1|ABF01483.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473084-1|ABF01482.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473083-1|ABF01481.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473082-1|ABF01480.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473081-1|ABF01479.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473080-1|ABF01478.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473079-1|ABF01477.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473078-1|ABF01476.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473077-1|ABF01475.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473076-1|ABF01474.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473075-1|ABF01473.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473074-1|ABF01472.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473073-1|ABF01471.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473072-1|ABF01470.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473071-1|ABF01469.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473070-1|ABF01468.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473069-1|ABF01467.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473068-1|ABF01466.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473067-1|ABF01465.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473066-1|ABF01464.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473065-1|ABF01463.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473064-1|ABF01462.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473063-1|ABF01461.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473062-1|ABF01460.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473061-1|ABF01459.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473060-1|ABF01458.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473059-1|ABF01457.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473058-1|ABF01456.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473057-1|ABF01455.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473056-1|ABF01454.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473055-1|ABF01453.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473054-1|ABF01452.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 >DQ473053-1|ABF01451.1| 290|Homo sapiens arylamine N-acetyltransferase 2 protein. Length = 290 Score = 29.9 bits (64), Expect = 9.1 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 559 TNF*FLQSQLLPKCKHNIVYKFNLK 633 TN FL S LLPK KH +Y F L+ Sbjct: 171 TNKEFLNSHLLPKKKHQKIYLFTLE 195 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,627,785 Number of Sequences: 237096 Number of extensions: 2450707 Number of successful extensions: 12585 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 11779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12541 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8063224416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -