BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20198 (588 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po... 26 4.7 SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharo... 25 6.2 SPBC947.08c |||histone promoter control protein Hpc2 |Schizosacc... 25 6.2 SPCC613.01 ||SPCC757.14|membrane transporter|Schizosaccharomyces... 25 8.2 >SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.8 bits (54), Expect = 4.7 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 480 QTRIPNKLKTTLCFVCRL*KKNDSFPHCCPKLRN 379 +++ NK+KTT+ V +L N + P C +LR+ Sbjct: 447 ESQSSNKIKTTIFPVSQLLFSNANVPAMCQRLRS 480 >SPAC15A10.06 |||CPA1 sodium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 25.4 bits (53), Expect = 6.2 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 Query: 356 LMAYF*Y*FLNFGQQ*GKLSFFFHNLQTKHKVVFNL 463 LMAY Y F N G +S F + KH FN+ Sbjct: 273 LMAYTSYFFSNGCHMSGVVSLLFCGITLKHYAFFNM 308 >SPBC947.08c |||histone promoter control protein Hpc2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 338 Score = 25.4 bits (53), Expect = 6.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 30 GESSPQDENTAQEGEAEGTPTPK 98 GES+ DE A G A+GT T K Sbjct: 56 GESTHVDEQQAANGAADGTQTIK 78 >SPCC613.01 ||SPCC757.14|membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 497 Score = 25.0 bits (52), Expect = 8.2 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -2 Query: 308 FKSYLQTWTFNLRLVHHLPYVFLVGTVALLCHLI 207 F ++L W + ++ + Y F++G VAL+ HL+ Sbjct: 364 FSTFLSKWLEDRQI---MLYGFMMGIVALIVHLV 394 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,952,318 Number of Sequences: 5004 Number of extensions: 33373 Number of successful extensions: 65 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 254167452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -