BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20198 (588 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 28 4.8 11_04_0057 - 12953479-12954364,12954484-12955034,12955125-129553... 27 8.4 >10_01_0083 - 1046086-1047086,1047976-1048161,1048266-1049247 Length = 722 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -3 Query: 262 ITFPMCSLSELWPCSATLFLSSGPLASDAPCKP 164 I FP L +++PCS+ + P D PCKP Sbjct: 336 IQFP--ELRDVYPCSSDGICKNRPGGYDCPCKP 366 >11_04_0057 - 12953479-12954364,12954484-12955034,12955125-12955342, 12957514-12957678,12960562-12960898 Length = 718 Score = 27.5 bits (58), Expect = 8.4 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 245 THREGDAP-VSN*MSMSEGNF*KYLLAILFSFILFYFDLMAY 367 T R G AP +SN ++ N+ +LLA+L + L YF + +Y Sbjct: 652 TGRNGMAPWLSNNLNEGHYNYYYFLLAVLGAIDLIYFIVCSY 693 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,819,359 Number of Sequences: 37544 Number of extensions: 194419 Number of successful extensions: 463 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -