BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20198 (588 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 4.2 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 9.7 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 23.8 bits (49), Expect = 4.2 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -2 Query: 329 IRLLTNIFKSYLQTWTFNLR---LVHHLPYV-FLVGTVALLCHLIFIKW 195 + ++ + S + FN R L+ +P + FLV A +C ++F KW Sbjct: 532 VHMIFGVCMSLVNHNHFNRRVNILLEFIPQMMFLVLLFAYMCFMMFFKW 580 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 22.6 bits (46), Expect = 9.7 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 302 SYLQ-TWTFNLRLVHHLPYVFLVGTVALL 219 +YLQ TW L LV FLV T+A+L Sbjct: 89 TYLQATWGCRLPLVQGGTISFLVPTLAIL 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 479,174 Number of Sequences: 2352 Number of extensions: 7231 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -