BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20198 (588 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase f... 28 4.0 >At2g24640.1 68415.m02943 ubiquitin carboxyl-terminal hydrolase family protein / zinc finger (MYND type) family protein similar to ubiquitin-specific protease 15 (UBP15) [Arabidopsis thaliana] GI:11993475; contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF01753: MYND finger Length = 672 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/84 (23%), Positives = 30/84 (35%), Gaps = 1/84 (1%) Frame = +3 Query: 27 SGESSPQDENTAQEGEAEGTPTPKPXXXXXXXXXXXXXXXXXXXP-EGLQGASEANGPLD 203 +G+ P EN A + TP P P E +E+N PL+ Sbjct: 589 NGKEDPTVENLAVDSSCLDITTPSPSAATEFIPQENERSDTESKPLEKEHSDTESNKPLE 648 Query: 204 KNKVAEQGHSSDKEHIGKVMHQSQ 275 K + + +KEH M +Q Sbjct: 649 KEHLDSESKPLEKEHSDTEMIDAQ 672 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,917,589 Number of Sequences: 28952 Number of extensions: 166386 Number of successful extensions: 352 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 352 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -