BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20195 (719 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 25 0.62 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 25 0.62 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 7.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 7.6 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 21 7.6 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 25.0 bits (52), Expect = 0.62 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 227 LDKLKAERELGITIDIALWKFETSKYYVTII 319 L KLK +LG + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 25.0 bits (52), Expect = 0.62 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 227 LDKLKAERELGITIDIALWKFETSKYYVTII 319 L KLK +LG + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 649 CCLRAIQKWARKRQQLGCSQSS*CMRIL 566 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 649 CCLRAIQKWARKRQQLGCSQSS*CMRIL 566 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 21.4 bits (43), Expect = 7.6 Identities = 21/79 (26%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +2 Query: 2 GTSGYYTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK 181 G G TQ V +G ++ H++ VIG + SG T Y KR +F+ Sbjct: 18 GGRGQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPI----KRKRVRFQT 73 Query: 182 EAQ-EMGKGSFKYAWVLDK 235 + + G S + W K Sbjct: 74 RVKVQEGSKSGRNKWFFQK 92 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,584 Number of Sequences: 336 Number of extensions: 3889 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -