BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20189 (753 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 22 4.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.0 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 22.2 bits (45), Expect = 4.6 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 1/77 (1%) Frame = +3 Query: 6 RGYYTQFVIRD*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA 185 RG TQ V +G ++ H++ VIG + SG T Y KR +F+ Sbjct: 20 RGQNTQRVQNQPLVIGCDEKHVSPHVIGGITSGGPIPTKSSKYPI----KRKRVRFQTRV 75 Query: 186 Q-EMGKGSFKYAWVLDK 233 + + G S + W K Sbjct: 76 KVQEGSKSGRNKWFFQK 92 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 646 CCLRAIQKWARKRQQLGCSQSS*CMRIL 563 CC A+ RQ + S+ C+R + Sbjct: 615 CCYHAVAPGTDIRQSIALSRKKKCIRYM 642 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -3 Query: 646 CCLRAIQKWARKRQQLGCSQSS*CMRIL 563 CC A+ RQ + S+ C+R + Sbjct: 507 CCYHAVAPGTDIRQSIALSRKKKCIRYM 534 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,277 Number of Sequences: 336 Number of extensions: 4051 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -