BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20184 (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 22 4.7 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 6.2 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 21 8.2 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 21 8.2 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 21 8.2 AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esteras... 21 8.2 AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esteras... 21 8.2 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = -1 Query: 567 QCSHARQLDALFGIEAFQVDRTFFISSS-----NIFSKYLY 460 QC + + +FG+ F DR+ F SS NI S + Y Sbjct: 289 QCYNTVEESRIFGLVTFTPDRSKFRPSSLRFCLNILSIFTY 329 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 94 ILILTGYVGAFYSFCEFSR 38 I +LT +G ++ CEFSR Sbjct: 452 ITLLT--IGLYFQLCEFSR 468 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 582 SVTDPQCSHARQLDALF 532 S+T+P SHA L LF Sbjct: 427 SITEPGVSHADDLGYLF 443 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 582 SVTDPQCSHARQLDALF 532 S+T+P SHA L LF Sbjct: 427 SITEPGVSHADDLGYLF 443 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 582 SVTDPQCSHARQLDALF 532 S+T+P SHA L LF Sbjct: 427 SITEPGVSHADDLGYLF 443 >AJ850288-1|CAH64508.1| 510|Tribolium castaneum putative esterase protein. Length = 510 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 582 SVTDPQCSHARQLDALF 532 S+T+P SHA L LF Sbjct: 427 SITEPGVSHADDLGYLF 443 >AJ850287-1|CAH64507.1| 509|Tribolium castaneum putative esterase protein. Length = 509 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 582 SVTDPQCSHARQLDALF 532 S+T+P SHA L LF Sbjct: 426 SITEPGVSHADDLGYLF 442 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,363 Number of Sequences: 336 Number of extensions: 3874 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -