BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20183 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 26 0.35 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.9 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 26.2 bits (55), Expect = 0.35 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +3 Query: 57 QQICSCSSCTHPTLLIFQQICCRKLR*IEDY 149 Q++ + C HPT+++ Q +C L+ I ++ Sbjct: 62 QKLLLSNPCKHPTIIMPQDVCFNDLKFIIEF 92 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.9 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 332 TSMSSRGYPSSSTK-EPFKPTLLDANTRNDHESNVRFYLFL 213 TS +SR S++T E FKP L + N H ++ + L Sbjct: 617 TSSASRENTSNTTSMESFKPPTLTESLLNRHNEDMEKLMML 657 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,138 Number of Sequences: 438 Number of extensions: 4177 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -